ARHGEF3 Antibody - N-terminal region (ARP57339_P050)

Catalog No: ARP57339_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: ARHG3
Sample Type: 786-0 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ARHG3
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: VKPLSRVTSLANLIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ARHGEF3 (ARP57339_P050) antibody is Catalog # AAP57339
• Reference: N/A

Target Info

• Gene Symbol: ARHGEF3
• Gene Full Name: Rho guanine nucleotide exchange factor 3
• Alias Symbols: GEF3, STA3, XPLN
• NCBI Gene Id: 50650
• Protein Name: rho guanine nucleotide exchange factor 3
• Description of Target: Rho-like GTPases are involved in a variety of cellular processes, and they are activated by binding GTP and inactivated by conversion of GTP to GDP by their intrinsic GTPase activity. Guanine nucleotide exchange factors (GEFs) accelerate the GTPase activity of Rho GTPases by catalyzing their release of bound GDP. This gene encodes a guanine nucleotide exchange factor, which specifically activates two members of the Rho GTPase family: RHOA and RHOB, both of which have a role in bone cell biology. It has been identified that genetic variation in this gene plays a role in the determination of bone mineral density (BMD), indicating the implication of this gene in postmenopausal osteoporosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q9NR81
• Protein Size (# AA): 526
• Molecular Weight: 57kDa
• Protein Interactions: CEP70; TRIM27; TRIM23; UBC; SUMO4; SUMO2; RHOA; RHOB;