Search Antibody, Protein, and ELISA Kit Solutions

ARHGEF10L Antibody - C-terminal region (ARP78902_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Rho guanine nucleotide exchange factor 10 like
NCBI Gene Id:
Protein Name:
rho guanine nucleotide exchange factor 10-like protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-141222 from Santa Cruz Biotechnology.
Description of Target:
ARHGEF10L is a member of the RhoGEF family of guanine nucleotide exchange factors (GEFs) that activate Rho GTPases (Winkler et al., 2005 [PubMed 16112081]).[supplied by OMIM, Dec 2008]
Protein Size (# AA):
Molecular Weight:
141 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ARHGEF10L.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ARHGEF10L.
The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGEF10L
Peptide Sequence:
Synthetic peptide located within the following region: SILAPDILRSDQEEAEGPRAEEDKPDGQAHEPMPDSHVGRELTRKKGILL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ARHGEF10L (ARP78902_P050) antibody is Catalog # AAP78902
Printable datasheet for anti-ARHGEF10L (ARP78902_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...