- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for ARHGDIA Antibody (OAAF07880) |
|---|
| Predicted Species Reactivity | Human|Mouse|Rat |
|---|---|
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin |
| Reconstitution and Storage | -20°C |
| Immunogen | The antiserum was produced against synthesized peptide derived from human ARHGDIA. |
| Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen. |
| Peptide Sequence | Synthetic peptide located within the following region: DKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDH |
| Concentration | 1mg/ml |
| Specificity | ARHGDIA Antibody detects endogenous levels of total ARHGDIA protein. |
| Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
| Application Info | IHC: 1:50~1:100 ELISA: 1:5000 |
| Gene Symbol | ARHGDIA |
|---|---|
| Gene Full Name | Rho GDP dissociation inhibitor alpha |
| Alias Symbols | epididymis secretory sperm binding protein Li 47e;GDIA1;GDP-dissociation inhibitor, aplysia RAS-related 1;HEL-S-47e;NPHS8;Rho GDP dissociation inhibitor (GDI) alpha;rho GDP-dissociation inhibitor 1;RHOGDI;Rho-GDI alpha;RHOGDI-1. |
| NCBI Gene Id | 396 |
| Protein Name | Rho GDP-dissociation inhibitor 1 |
| Description of Target | Controls Rho proteins homeostasis. Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Retains Rho proteins such as CDC42, RAC1 and RHOA in an inactive cytosolic pool, regulating their stability and protecting them from degradation. Actively involved in the recycling and distribution of activated Rho GTPases in the cell, mediates extraction from membranes of both inactive and activated molecules due its exceptionally high affinity for prenylated forms. Through the modulation of Rho proteins, may play a role in cell motility regulation. In glioma cells, inhibits cell migration and invasion by mediating the signals of SEMA5A and PLXNB3 that lead to inactivation of RAC1. |
| Uniprot ID | P52565 |
| Molecular Weight | 23 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "ARHGDIA Antibody (OAAF07880)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "ARHGDIA Antibody (OAAF07880)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "ARHGDIA Antibody (OAAF07880)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "ARHGDIA Antibody (OAAF07880)"?
This target may also be called "epididymis secretory sperm binding protein Li 47e;GDIA1;GDP-dissociation inhibitor, aplysia RAS-related 1;HEL-S-47e;NPHS8;Rho GDP dissociation inhibitor (GDI) alpha;rho GDP-dissociation inhibitor 1;RHOGDI;Rho-GDI alpha;RHOGDI-1." in publications.
-
What is the shipping cost for "ARHGDIA Antibody (OAAF07880)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "ARHGDIA Antibody (OAAF07880)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "ARHGDIA Antibody (OAAF07880)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "23 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "ARHGDIA Antibody (OAAF07880)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ARHGDIA"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ARHGDIA"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ARHGDIA"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ARHGDIA"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ARHGDIA"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ARHGDIA"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
