Search Antibody, Protein, and ELISA Kit Solutions

ARHGAP26 Antibody - middle region (ARP73910_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73910_P050-FITC Conjugated

ARP73910_P050-HRP Conjugated

ARP73910_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ARHGAP26
Official Gene Full Name:
Rho GTPase activating protein 26
NCBI Gene Id:
23092
Protein Name:
rho GTPase-activating protein 26
Swissprot Id:
Q9UNA1
Protein Accession #:
NP_055886
Alias Symbols:
GRAF, GRAF1, OPHN1L, OPHN1L1
Description of Target:
Interaction of a cell with the extracellular matrix triggers integrin cell surface receptors to begin signaling cascades that regulate the organization of the actin-cytoskeleton. One of the proteins involved in these cascades is focal adhesion kinase. The protein encoded by this gene is a GTPase activating protein that binds to focal adhesion kinase and mediates the activity of the GTP binding proteins RhoA and Cdc42. Defects in this gene are a cause of juvenile myelomonocytic leukemia (JMML). Multiple transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
814
Molecular Weight:
89kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ARHGAP26.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ARHGAP26.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human RHG26
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LWMEAMDGREPVYNSNKDSQSEGTAQLDSIGFSIIRKCIHAVETRGINEQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CDC42EP2; SRPK1; UBC; PTEN; PKN3; PKN1; PTK2; INSR; CDC42; RHOA;
Blocking Peptide:
For anti-ARHGAP26 (ARP73910_P050) antibody is Catalog # AAP73910
Datasheets/Manuals:
Printable datasheet for anti-ARHGAP26 (ARP73910_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...