Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP73910_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP73910_P050-FITC Conjugated

ARP73910_P050-HRP Conjugated

ARP73910_P050-Biotin Conjugated

ARHGAP26 Antibody - middle region (ARP73910_P050)

Catalog#: ARP73910_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human RHG26
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: LWMEAMDGREPVYNSNKDSQSEGTAQLDSIGFSIIRKCIHAVETRGINEQ
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ARHGAP26 (ARP73910_P050) antibody is Catalog # AAP73910
Datasheets/ManualsPrintable datasheet for anti-ARHGAP26 (ARP73910_P050) antibody
Gene SymbolARHGAP26
Official Gene Full NameRho GTPase activating protein 26
Alias SymbolsGRAF, GRAF1, OPHN1L, OPHN1L1
NCBI Gene Id23092
Protein Namerho GTPase-activating protein 26
Description of TargetInteraction of a cell with the extracellular matrix triggers integrin cell surface receptors to begin signaling cascades that regulate the organization of the actin-cytoskeleton. One of the proteins involved in these cascades is focal adhesion kinase. The protein encoded by this gene is a GTPase activating protein that binds to focal adhesion kinase and mediates the activity of the GTP binding proteins RhoA and Cdc42. Defects in this gene are a cause of juvenile myelomonocytic leukemia (JMML). Multiple transcript variants encoding different isoforms have been found for this gene.
Swissprot IdQ9UNA1
Protein Accession #NP_055886
Protein Size (# AA)814
Molecular Weight89kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ARHGAP26.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ARHGAP26.
Protein InteractionsCDC42EP2; SRPK1; UBC; PTEN; PKN3; PKN1; PTK2; INSR; CDC42; RHOA;
Write Your Own Review
You're reviewing:ARHGAP26 Antibody - middle region (ARP73910_P050)
Your Rating
Free Microscope
Aviva Pathways
Assay Development
Aviva Blast Tool