ARHGAP25 Antibody - middle region : Biotin (ARP58423_P050-Biotin)

Catalog No: ARP58423_P050-Biotin

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP25
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 92%; Horse: 92%; Human: 100%; Pig: 86%; Rabbit: 92%; Rat: 79%
• Peptide Sequence: Synthetic peptide located within the following region: SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ARHGAP25 (ARP58423_P050-Biotin) antibody is Catalog # AAP58423 (Previous Catalog # AAPP34710)
• Reference: Katoh,M. (2004) Int. J. Mol. Med. 14 (2), 333-338

Target Info

• Gene Symbol: ARHGAP25
• Gene Full Name: Rho GTPase activating protein 25
• Alias Symbols: KAIA0053, HEL-S-308
• NCBI Gene Id: 9938
• Protein Name: Rho GTPase-activating protein 25
• Description of Target: ARHGAPs, such as ARHGAP25, are negative regulators of Rho GTPases, which are implicated in actin remodeling, cell polarity, and cell migration.ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA; MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).[supplied by OMIM].
• Uniprot ID: P42331
• Protein Accession #: NP_055697
• Nucleotide Accession #: NM_014882
• Protein Size (# AA): 638
• Molecular Weight: 70kDa
• Protein Interactions: UBC;