ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: ARP58423_P050
Price: $0.00
SKU
ARP58423_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ARHGAP25 Antibody - middle region (ARP58423_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ARHGAP25 (ARP58423_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ARHGAP25
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 92%; Horse: 92%; Human: 100%; Pig: 86%; Rabbit: 92%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL
Concentration0.5 mg/ml
Blocking PeptideFor anti-ARHGAP25 (ARP58423_P050) antibody is Catalog # AAP58423 (Previous Catalog # AAPP34710)
ReferenceKatoh,M. (2004) Int. J. Mol. Med. 14 (2), 333-338
Gene SymbolARHGAP25
Gene Full NameRho GTPase activating protein 25
Alias SymbolsKAIA0053, HEL-S-308
NCBI Gene Id9938
Protein NameRho GTPase-activating protein 25
Description of TargetARHGAPs, such as ARHGAP25, are negative regulators of Rho GTPases, which are implicated in actin remodeling, cell polarity, and cell migration.ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA; MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).[supplied by OMIM].
Uniprot IDP42331
Protein Accession #NP_055697
Nucleotide Accession #NM_014882
Protein Size (# AA)638
Molecular Weight70kDa
Protein InteractionsUBC;
  1. What is the species homology for "ARHGAP25 Antibody - middle region (ARP58423_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "ARHGAP25 Antibody - middle region (ARP58423_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ARHGAP25 Antibody - middle region (ARP58423_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ARHGAP25 Antibody - middle region (ARP58423_P050)"?

    This target may also be called "KAIA0053, HEL-S-308" in publications.

  5. What is the shipping cost for "ARHGAP25 Antibody - middle region (ARP58423_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ARHGAP25 Antibody - middle region (ARP58423_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ARHGAP25 Antibody - middle region (ARP58423_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "70kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ARHGAP25 Antibody - middle region (ARP58423_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ARHGAP25"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ARHGAP25"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ARHGAP25"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ARHGAP25"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ARHGAP25"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ARHGAP25"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ARHGAP25 Antibody - middle region (ARP58423_P050)
Your Rating
We found other products you might like!