Search Antibody, Protein, and ELISA Kit Solutions

ARHGAP1 Antibody - N-terminal region (ARP54722_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54722_P050-FITC Conjugated

ARP54722_P050-HRP Conjugated

ARP54722_P050-Biotin Conjugated

Gene Symbol:
ARHGAP1
Official Gene Full Name:
Rho GTPase activating protein 1
NCBI Gene Id:
392
Protein Name:
Rho GTPase-activating protein 1
Swissprot Id:
Q07960
Protein Accession #:
NP_004299
Nucleotide Accession #:
NM_004308
Alias Symbols:
CDC42GAP, RHOGAP, RHOGAP1, p50rhoGAP
Replacement Item:
This antibody may replace item sc-109201 from Santa Cruz Biotechnology.
Description of Target:
ARHGAP1 is a GTPase activator for the Rho, Rac and Cdc42 proteins, converting them to the putatively inactive GDP-bound state. Cdc42 seems to be the preferred substrate.
Protein Size (# AA):
439
Molecular Weight:
50kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ARHGAP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ARHGAP1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGAP1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Complete computational species homology data:
Anti-ARHGAP1 (ARP54722_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
EGFR; NEDD8; RHOA; SOX2; CHEK2; UBC; CDC42; BNIPL; HSP90AB1; KIF1B; TAX1BP1; BNIP2; EPB41L1; ARHGAP1; BAI2; SMARCD3; WAS; TUBA4A; SRC; PTPN11; PIK3R1; RHOC; ITPR1; HMGCR; RASA1; RAC1; ARHGAP8;
Blocking Peptide:
For anti-ARHGAP1 (ARP54722_P050) antibody is Catalog # AAP54722 (Previous Catalog # AAPP43948)
Datasheets/Manuals:
Printable datasheet for anti-ARHGAP1 (ARP54722_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...