- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
ARGFX Antibody - N-terminal region (ARP47510_P050)
| Datasheets/Manuals | Printable datasheet for anti-ARGFX (ARP47510_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Cow, Pig |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ARGFX |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 90%; Human: 100%; Pig: 91% |
| Peptide Sequence | Synthetic peptide located within the following region: TTAIRRRHKERTSFTHQQYEELEALFSQTMFPDRNLQEKLALRLDLPEST |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ARGFX (ARP47510_P050) antibody is Catalog # AAP47510 (Previous Catalog # AAPP28347) |
| Reference | Booth,H.A. Gene 387 (1-2), 7-14 (2007) |
| Gene Symbol | ARGFX |
|---|---|
| Gene Full Name | Arginine-fifty homeobox |
| Alias Symbols | - |
| NCBI Gene Id | 503582 |
| Protein Name | Arginine-fifty homeobox |
| Description of Target | ARGFX belongs to the paired homeobox family.Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain.Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the ARGFX homeobox gene family. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-83 AC069239.16 30152-30234 c 84-198 AC069239.16 27349-27463 c 199-315 AC069239.16 21265-21381 c 316-464 AC069239.16 13100-13248 c 465-5065 AC069239.16 7543-12143 c |
| Uniprot ID | A6NJG6 |
| Protein Accession # | NP_001012677 |
| Nucleotide Accession # | NM_001012659 |
| Protein Size (# AA) | 315 |
| Molecular Weight | 35kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "ARGFX Antibody - N-terminal region (ARP47510_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Pig".
-
How long will it take to receive "ARGFX Antibody - N-terminal region (ARP47510_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "ARGFX Antibody - N-terminal region (ARP47510_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "ARGFX Antibody - N-terminal region (ARP47510_P050)"?
This target may also be called "-" in publications.
-
What is the shipping cost for "ARGFX Antibody - N-terminal region (ARP47510_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "ARGFX Antibody - N-terminal region (ARP47510_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "ARGFX Antibody - N-terminal region (ARP47510_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "35kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "ARGFX Antibody - N-terminal region (ARP47510_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ARGFX"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ARGFX"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ARGFX"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ARGFX"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ARGFX"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ARGFX"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
