Size:100 ul
$319.00
In stock
SKU
ARP54567_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54567_P050-FITC Conjugated

ARP54567_P050-HRP Conjugated

ARP54567_P050-Biotin Conjugated

ARG2 Antibody - C-terminal region (ARP54567_P050)

Catalog#: ARP54567_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IP
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-114274 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ARG2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 87%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology dataAnti-ARG2 (ARP54567_P050)
Peptide SequenceSynthetic peptide located within the following region: SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ARG2 (ARP54567_P050) antibody is Catalog # AAP54567 (Previous Catalog # AAPP31351)
Datasheets/ManualsPrintable datasheet for anti-ARG2 (ARP54567_P050) antibody
Sample Type Confirmation

ARG2 is supported by BioGPS gene expression data to be expressed in Jurkat

Target ReferenceMumenthaler,S.M., (2008) Int. J. Oncol. 32 (2), 357-365
Publications

Lukasova, M., Malaval, C., Gille, A., Kero, J. & Offermanns, S. Nicotinic acid inhibits progression of atherosclerosis in mice through its receptor GPR109A expressed by immune cells. J. Clin. Invest. 121, 1163-73 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 21317532

Gene SymbolARG2
Official Gene Full NameArginase, type II
Alias Symbols-
NCBI Gene Id384
Protein NameArginase-2, mitochondrial
Description of TargetArginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. ARG2 (type II isoform) is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood; it is thought to play a role in nitric oxide and polyamine metabolism.Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type II isoform encoded by this gene, is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood; it is thought to play a role in nitric oxide and polyamine metabolism. Transcript variants of the type II gene resulting from the use of alternative polyadenylation sites have been described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdP78540
Protein Accession #NP_001163
Nucleotide Accession #NM_001172
Protein Size (# AA)354
Molecular Weight39kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ARG2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ARG2.
Protein InteractionsUBC; ARG1;
Write Your Own Review
You're reviewing:ARG2 Antibody - C-terminal region (ARP54567_P050)
Your Rating
Aviva Travel Grant
Assay Development
Free Microscope
Aviva Blast Tool