ARG1 Recombinant Protein (Mouse) (OPCA02305)

Catalog No: OPCA02305

Arg1 Recombinant Protein (Mouse) (OPCA02305) in SDS-PAGE showing the molecular weight of approximately 50.79 kDa.

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Lyophilized 20mM Tris-HCl, 0.5M NaCl, 6% Trehalose
• Host: Mouse
• Reconstitution and Storage: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: Full Length: MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK
• Source: E.coli
• Protein Range: 1-323 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)
• Gene Symbol: Arg1
• Gene Full Name: arginase, liver
• Alias Symbols: AI;AI256583;Arg;Arg-1;arginase 1, liver;arginase I;arginase-1;liver-type arginase;PG;PGIF;type I arginase.
• NCBI Gene Id: 11846
• Protein Name: Arginase-1
• Description of Target: Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.
• Uniprot ID: Q61176
• Protein Accession #: NP_031508.1
  
• Nucleotide Accession #: NM_007482.3
• Protein Size (# AA): Recombinant
• Molecular Weight: 51 kDa