Search Antibody, Protein, and ELISA Kit Solutions

ARG1 Antibody - N-terminal region (ARP45672_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45672_T100-FITC Conjugated

ARP45672_T100-HRP Conjugated

ARP45672_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Additional Information:
IHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-118521, HPA003595, HPA024006
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ARG1
Purification:
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 100%
Complete computational species homology data:
Anti-ARG1 (ARP45672_T100)
Peptide Sequence:
Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ARG1 (ARP45672_T100) antibody is Catalog # AAP45672 (Previous Catalog # AAPP25826)
Datasheets/Manuals:
Printable datasheet for anti-ARG1 (ARP45672_T100) antibody
Target Reference:
Orellana,M.S., (2002) Arch. Biochem. Biophys. 403 (2), 155-159
Publications:

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 24465277

Gene Symbol:
ARG1
Official Gene Full Name:
Arginase, liver
NCBI Gene Id:
383
Protein Name:
Arginase-1
Description of Target:
Arginase catalyzes the hydrolysis of arginine to ornithine and urea. The type I isoform of ARG1, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.
Swissprot Id:
P05089
Protein Accession #:
NP_000036
Nucleotide Accession #:
NM_000045
Protein Size (# AA):
322
Molecular Weight:
35kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ARG1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ARG1.
Protein Interactions:
RPA3; RPA2; RPA1; SUZ12; EZH2; BMI1; ALDH4A1; ESR1; RAD21; UBC; UCHL5; ATG101; USP53; FLOT1; NOS1; ARG2;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...