Size:100 ul
$249.00
In Stock
SKU
ARP45672_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45672_T100-FITC Conjugated

ARP45672_T100-HRP Conjugated

ARP45672_T100-Biotin Conjugated

ARG1 Antibody - N-terminal region (ARP45672_T100)

Catalog#: ARP45672_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-118521, HPA003595, HPA024006
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ARG1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 100%
Complete computational species homology data Anti-ARG1 (ARP45672_T100)
Peptide Sequence Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ARG1 (ARP45672_T100) antibody is Catalog # AAP45672 (Previous Catalog # AAPP25826)
Datasheets/Manuals Printable datasheet for anti-ARG1 (ARP45672_T100) antibody
Target Reference Orellana,M.S., (2002) Arch. Biochem. Biophys. 403 (2), 155-159
Publications

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 24465277

Gene Symbol ARG1
Official Gene Full Name Arginase, liver
NCBI Gene Id 383
Protein Name Arginase-1
Description of Target Arginase catalyzes the hydrolysis of arginine to ornithine and urea. The type I isoform of ARG1, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.
Swissprot Id P05089
Protein Accession # NP_000036
Nucleotide Accession # NM_000045
Protein Size (# AA) 322
Molecular Weight 35kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ARG1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ARG1.
Protein Interactions RPA3; RPA2; RPA1; SUZ12; EZH2; BMI1; ALDH4A1; ESR1; RAD21; UBC; UCHL5; ATG101; USP53; FLOT1; NOS1; ARG2;
  1. What is the species homology for "ARG1 Antibody - N-terminal region (ARP45672_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "ARG1 Antibody - N-terminal region (ARP45672_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ARG1 Antibody - N-terminal region (ARP45672_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ARG1 Antibody - N-terminal region (ARP45672_T100)"?

    This target may also be called "" in publications.

  5. What is the shipping cost for "ARG1 Antibody - N-terminal region (ARP45672_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ARG1 Antibody - N-terminal region (ARP45672_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ARG1 Antibody - N-terminal region (ARP45672_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ARG1 Antibody - N-terminal region (ARP45672_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ARG1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ARG1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ARG1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ARG1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ARG1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ARG1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ARG1 Antibody - N-terminal region (ARP45672_T100)
Your Rating
We found other products you might like!