SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP61868_P050
Price: $0.00
SKU
ARP61868_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ARFGAP3 (ARP61868_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 100%; Horse: 93%; Human: 100%; Pig: 79%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: SYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKKFGNVKA
Concentration0.5 mg/ml
Blocking PeptideFor anti-ARFGAP3 (ARP61868_P050) antibody is Catalog # AAP61868
Gene SymbolARFGAP3
Gene Full NameADP-ribosylation factor GTPase activating protein 3
Alias SymbolsARFGAP1
NCBI Gene Id26286
Protein NameADP-ribosylation factor GTPase-activating protein 3
Description of TargetThe protein encoded by this gene is a GTPase-activating protein (GAP) that associates with the Golgi apparatus and regulates the early secretory pathway of proteins. The encoded protein promotes hydrolysis of ADP-ribosylation factor 1 (ARF1)-bound GTP, which is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is a prerequisite for the fusion of these vesicles with target compartments. The activity of this protein is sensitive to phospholipids. Multiple transcript variants encoding different isoforms have been found for this gene. This gene was originally known as ARFGAP1, but that is now the name of a related but different gene.
Uniprot IDQ9NP61
Protein Accession #NP_055385
Nucleotide Accession #NM_014570
Protein Size (# AA)516
Molecular Weight57kDa
Protein InteractionsUBC; CXCL8; CD14; APP; SMAD2;
  1. What is the species homology for "ARFGAP3 Antibody - C-terminal region (ARP61868_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Horse, Pig".

  2. How long will it take to receive "ARFGAP3 Antibody - C-terminal region (ARP61868_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ARFGAP3 Antibody - C-terminal region (ARP61868_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ARFGAP3 Antibody - C-terminal region (ARP61868_P050)"?

    This target may also be called "ARFGAP1" in publications.

  5. What is the shipping cost for "ARFGAP3 Antibody - C-terminal region (ARP61868_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ARFGAP3 Antibody - C-terminal region (ARP61868_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ARFGAP3 Antibody - C-terminal region (ARP61868_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ARFGAP3 Antibody - C-terminal region (ARP61868_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ARFGAP3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ARFGAP3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ARFGAP3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ARFGAP3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ARFGAP3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ARFGAP3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ARFGAP3 Antibody - C-terminal region (ARP61868_P050)
Your Rating