- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-ARF6 (ARP54598_P050) antibody |
---|
Tested Species Reactivity | Human | ||||||
---|---|---|---|---|---|---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish | ||||||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||||||
Clonality | Polyclonal | ||||||
Host | Rabbit | ||||||
Application | IHC, WB | ||||||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||||||
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ARF6 | ||||||
Purification | Affinity Purified | ||||||
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100% | ||||||
Peptide Sequence | Synthetic peptide located within the following region: REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG | ||||||
Concentration | 0.5 mg/ml | ||||||
Blocking Peptide | For anti-ARF6 (ARP54598_P050) antibody is Catalog # AAP54598 (Previous Catalog # AAPP31382) | ||||||
Sample Type Confirmation | ARF6 is strongly supported by BioGPS gene expression data to be expressed in MCF7 | ||||||
Enhanced Validation |
| ||||||
Reference | Karim,Z.A., (2008) J. Biol. Chem. 283 (18), 11995-12003 | ||||||
Publications | Arf6 regulates the cycling and the readily releasable pool of synaptic vesicles at hippocampal synapse. Elife. 5, (2016). 26731518 |
Gene Symbol | ARF6 |
---|---|
Gene Full Name | ADP-ribosylation factor 6 |
Alias Symbols | DKFZp564M0264 |
NCBI Gene Id | 382 |
Protein Name | ADP-ribosylation factor 6 |
Description of Target | ARF6 is a member of the human ARF family, which is part of the RAS superfamily. They are small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. ARF6 is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | P62330 |
Protein Accession # | NP_001654 |
Nucleotide Accession # | NM_001663 |
Protein Size (# AA) | 175 |
Molecular Weight | 20 kDa |
Protein Interactions | UBC; LSB5; GGA1; STAU1; EGFR; CYTH1; CYTH2; GNAQ; FN1; VCP; APP; RAB11FIP3; RAB11FIP4; RAB11FIP5; USP6; IKBKG; GGA3; ITSN1; ASAP1; FBXO8; MEPCE; RUVBL2; ASAP3; MPP5; ZNF709; EXOC5; ARFIP2; AP3D1; PIP5K1C; ASAP2; AP3B1; PIP5K1A; PLD1; AP1B1; EZR; CHRM3; CA |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "ARF6 Antibody - middle region (ARP54598_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".
-
How long will it take to receive "ARF6 Antibody - middle region (ARP54598_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "ARF6 Antibody - middle region (ARP54598_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "ARF6 Antibody - middle region (ARP54598_P050)"?
This target may also be called "DKFZp564M0264" in publications.
-
What is the shipping cost for "ARF6 Antibody - middle region (ARP54598_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "ARF6 Antibody - middle region (ARP54598_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "ARF6 Antibody - middle region (ARP54598_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "20 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "ARF6 Antibody - middle region (ARP54598_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ARF6"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ARF6"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ARF6"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ARF6"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ARF6"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ARF6"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.