AQP4 Recombinant Protein (Human) (OPCA02594)

Catalog No: OPCA02594

AQP4 Recombinant Protein (Human) (OPCA02594) in SDS-PAGE showing the molecular weight of approximately 9.98 kDa.

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid 20mM Tris, 150mM NaCl, 10% glycerol
• Host: Human
• Reconstitution and Storage: Store at -20°C; for extended storage, conserve at -20°C or -80°C. Store working aliquots at 4°C for up to one week. Avoid repeated freeze/thaw cycles.
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: Partial Protein: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
• Source: Yeast
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Crystal structure of human aquaporin 4 at 1.8 A and its mechanism of conductance.Ho J.D., Yeh R., Sandstrom A., Chorny I., Harries W.E., Robbins R.A., Miercke L.J., Stroud R.M.Proc. Natl. Acad. Sci. U.S.A. 106:7437-7442(2009)
• Gene Symbol: AQP4
• Gene Full Name: aquaporin 4
• Alias Symbols: aquaporin type4;aquaporin-4;mercurial-insensitive water channel;MIWC;WCH4.
• NCBI Gene Id: 361
• Protein Name: Aquaporin-4
• Description of Target: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.
• Uniprot ID: P55087
• Protein Accession #: NP_001641.1
  
• Nucleotide Accession #: NM_001650.5
• Protein Size (# AA): Recombinant
• Molecular Weight: 10 kDa