APPD Antibody - C-terminal region (AVARP09055_T100)

Catalog No: AVARP09055_T100

Host: Rabbit
Target Name: APPD
Sample Tissue: Human Jurkat Whole cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human APPD
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 92%; Human: 100%; Mouse: 92%; Rat: 92%; Yeast: 100%
• Peptide Sequence: Synthetic peptide located within the following region: QPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-PLEKHF1 (AVARP09055_T100) antibody is Catalog # AAP30553 (Previous Catalog # AAPP01205)
• Reference: Strausberg, R.L., et al (2002) Proc. Natl. Acad. Sci. U.S.A. 99:16899-16903.

Target Info

• Gene Symbol: PLEKHF1
• Gene Full Name: Pleckstrin homology domain containing, family F (with FYVE domain) member 1
• Alias Symbols: APPD, LAPF, PHAFIN1, ZFYVE15
• NCBI Gene Id: 79156
• Protein Name: Pleckstrin homology domain-containing family F member 1
• Description of Target: APPD (Apoptosis-inducing protein D; phafin 1) is predicted through gene annotation and contains pleckstrin homology domain. It may binds to two Zn++ ions through its FYVE zinc finger domain. Biological function of this protein has not been clearly mapped yet.
• Uniprot ID: Q96K11
• Protein Accession #: NP_077286
• Nucleotide Accession #: NM_024310
• Protein Size (# AA): 279
• Molecular Weight: 31kDa
• Protein Interactions: L3MBTL3; UBC; KIAA1279; TNNT1;