APOL2 Antibody - middle region (ARP49974_P050)

Catalog No: ARP49974_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-APOL2 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APOL2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Rabbit: 79%
• Peptide Sequence: Synthetic peptide located within the following region: DVVSLAYESKHLLEGAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-APOL2 (ARP49974_P050) antibody is Catalog # AAP49974 (Previous Catalog # AAPP44258)

Target Info

• Gene Symbol: APOL2
• Gene Full Name: Apolipoprotein L, 2
• Alias Symbols: APOL3, APOL-II
• NCBI Gene Id: 23780
• Protein Name: Apolipoprotein L2
• Description of Target: This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. Two transcript variants encoding the same protein have been found for this gene.
• Uniprot ID: Q9BQE5
• Protein Accession #: NP_112092
• Nucleotide Accession #: NM_030882
• Protein Size (# AA): 337
• Molecular Weight: 37kDa
• Protein Interactions: UBC; AR;