SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: OPCA05202
Price: $0.00
SKU
OPCA05202
Availability: Domestic: within 4-6 weeks delivery | International: 4-6 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

APOE Recombinant Protein (Rabbit) (OPCA05202)

Datasheets/ManualsPrintable datasheet for OPCA05202
Product Info
Predicted Species ReactivityRabbit
Product FormatLiquid
Additional InformationSpecies Specificity Detail: Oryctolagus cuniculus (Rabbit)
Reconstitution and StorageBriefly centrifuge lyophilized product prior to opening to bring the contents to the bottom. Please reconstitute protein to 0.1-1.0 mg/mL by adding deionized sterile water first, followed by addition of glycerol to a final concentration of 5-50%. Reconstituted product should be aliquoted for long-term storage at -20C/-80C. Our in house default final concentration of glycerol is 50% for reference. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
FormulationTris-base, 50% glycerol
PurityGreater than 90% as determined by SDS-PAGE.
Protein SequencePartial: TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ
Storage BufferTris-base, 50% glycerol
SourceE.coli
TagN-terminal 10xHis-tagged and C-terminal Myc-tagged
ReferenceIsolation and characterization of a full-length rabbit apolipoprotein E cDNA.
Hao Q.L., Yamin T.T., Pan T.C., Chen S.L., Chen B.S., Kroon P.A., Chao Y.S.
Atherosclerosis 66:125-130(1987)
Gene SymbolAPOE
NCBI Gene Id100009337
Protein NameApolipoprotein E
Description of TargetMediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.
Uniprot IDP18287
Protein Accession #NP_001076112
Nucleotide Accession #NM_001082643
Molecular Weight39 kDa
Write Your Own Review
You're reviewing:APOE Recombinant Protein (Rabbit) (OPCA05202)
Your Rating
We found other products you might like!