Size:100 ul
$319.00
In Stock
SKU
ARP54283_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54283_P050-FITC Conjugated

ARP54283_P050-HRP Conjugated

ARP54283_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse, Rat
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Additional Information IHC Information: Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-13521 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human APOE
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-APOE (ARP54283_P050)
Peptide Sequence Synthetic peptide located within the following region: KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-APOE (ARP54283_P050) antibody is Catalog # AAP54283 (Previous Catalog # AAPP31032)
Datasheets/Manuals Printable datasheet for anti-APOE (ARP54283_P050) antibody
Target Reference Ho,R.C., (2008) Am J Geriatr Psychiatry 16 (6), 519-522
Publications

Day, RJ; McCarty, KL; Ockerse, KE; Head, E; Rohn, TT; Proteolytic Cleavage of Apolipoprotein E in the Down Syndrome Brain. 7, 267-77 (2016). WB, IHC, Human 27330841

Rohn, T. T., Catlin, L. W., Coonse, K. G. & Habig, J. W. Identification of an amino-terminal fragment of apolipoprotein E4 that localizes to neurofibrillary tangles of the Alzheimer’s disease brain. Brain Res. 1475, 106-15 (2012). WB, IHC, Human 22902767

Rohn, T. T., Day, R. J., Sheffield, C. B., Rajic, A. J. & Poon, W. W. Apolipoprotein E pathology in vascular dementia. Int. J. Clin. Exp. Pathol. 7, 938-47 (2014). WB, IHC, Human 24696712

Gene Symbol APOE
Official Gene Full Name Apolipoprotein E
Alias Symbols AD2, MGC1571, apoprotein, LPG, LDLCQ5
NCBI Gene Id 348
Protein Name Apolipoprotein E
Description of Target Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P02649
Protein Accession # NP_000032
Nucleotide Accession # NM_000041
Protein Size (# AA) 317
Molecular Weight 34kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express APOE.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express APOE.
Protein Interactions LCAT; ARFGAP1; ALB; C19orf52; LOXL4; PRAM1; MID1IP1; ANKH; FBXL12; FXYD7; ECSIT; PDCD4; IFIT5; MAST1; EPN2; PLEKHA6; CDC37; IQSEC1; LONP1; TYRO3; PRDX2; ST13; RPL4; RHEB; PSEN1; HTRA1; PCMT1; ZNF558; NOS3; IFIT3; GCDH; FOXG1; FARSA; ELAVL1; CYP2C18; CYP2C
  1. What is the species homology for "APOE Antibody - N-terminal region (ARP54283_P050)"?

    The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "APOE Antibody - N-terminal region (ARP54283_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "APOE Antibody - N-terminal region (ARP54283_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "APOE Antibody - N-terminal region (ARP54283_P050)"?

    This target may also be called "AD2, MGC1571, apoprotein, LPG, LDLCQ5" in publications.

  5. What is the shipping cost for "APOE Antibody - N-terminal region (ARP54283_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "APOE Antibody - N-terminal region (ARP54283_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "APOE Antibody - N-terminal region (ARP54283_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "APOE Antibody - N-terminal region (ARP54283_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "APOE"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "APOE"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "APOE"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "APOE"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "APOE"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "APOE"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:APOE Antibody - N-terminal region (ARP54283_P050)
Your Rating
We found other products you might like!