Search Antibody, Protein, and ELISA Kit Solutions

APOE Antibody - N-terminal region (ARP54283_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54283_P050-FITC Conjugated

ARP54283_P050-HRP Conjugated

ARP54283_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Apolipoprotein E
NCBI Gene Id:
Protein Name:
Apolipoprotein E
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
AD2, MGC1571, apoprotein, LPG, LDLCQ5
Replacement Item:
This antibody may replace item sc-13521 from Santa Cruz Biotechnology.
Description of Target:
Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express APOE.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express APOE.
The immunogen is a synthetic peptide directed towards the N terminal region of human APOE
Predicted Species Reactivity:
Tested Species Reactivity:
Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-APOE (ARP54283_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-APOE (ARP54283_P050) antibody is Catalog # AAP54283 (Previous Catalog # AAPP31032)
Printable datasheet for anti-APOE (ARP54283_P050) antibody
Additional Information:
IHC Information: Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Ho,R.C., (2008) Am J Geriatr Psychiatry 16 (6), 519-522

Day, RJ; McCarty, KL; Ockerse, KE; Head, E; Rohn, TT; Proteolytic Cleavage of Apolipoprotein E in the Down Syndrome Brain. 7, 267-77 (2016). WB, IHC, Human 27330841

Rohn, T. T., Catlin, L. W., Coonse, K. G. & Habig, J. W. Identification of an amino-terminal fragment of apolipoprotein E4 that localizes to neurofibrillary tangles of the Alzheimer’s disease brain. Brain Res. 1475, 106-15 (2012). WB, IHC, Human 22902767

Rohn, T. T., Day, R. J., Sheffield, C. B., Rajic, A. J. & Poon, W. W. Apolipoprotein E pathology in vascular dementia. Int. J. Clin. Exp. Pathol. 7, 938-47 (2014). WB, IHC, Human 24696712

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...