Size:100 ul
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33540_T100-FITC Conjugated

ARP33540_T100-HRP Conjugated

ARP33540_T100-Biotin Conjugated

APOBEC3G Antibody - N-terminal region (ARP33540_T100)

Catalog#: ARP33540_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human, Pig
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-130689 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3G
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Human: 100%; Pig: 79%
Complete computational species homology data Anti-APOBEC3G (ARP33540_T100)
Peptide Sequence Synthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-APOBEC3G (ARP33540_T100) antibody is Catalog # AAP33540
Datasheets/Manuals Printable datasheet for anti-APOBEC3G (ARP33540_T100) antibody
Sample Type Confirmation

APOBEC3G is strongly supported by BioGPS gene expression data to be expressed in Daudi

Target Reference Rose,K.M., et al., (2004) J. Biol. Chem. 279 (40), 41744-41749

Chen, H., Wang, L.-W., Huang, Y.-Q. & Gong, Z.-J. Interferon-alpha Induces High Expression of APOBEC3G and STAT-1 in Vitro and in Vivo. Int. J. Mol. Sci. 11, 3501-12 (2010). WB, Human, Pig 20957108

Gene Symbol APOBEC3G
Official Gene Full Name Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
Alias Symbols ARCD, ARP9, ARP-9, CEM15, CEM-15, MDS019, bK150C2.7, dJ494G10.1
NCBI Gene Id 60489
Protein Name DNA dC->dU-editing enzyme APOBEC-3G
Description of Target Anti-APOBEC3G is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity.
Swissprot Id Q9HC16
Protein Accession # NP_068594
Nucleotide Accession # NM_021822
Protein Size (# AA) 384
Molecular Weight 46kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express APOBEC3G.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express APOBEC3G.
Protein Interactions vpr; vif; UNG1; APP; UBC; CBFB; APOBEC3G; HSPA4; gag; PTN; PRKACA; UBA52;
Write Your Own Review
You're reviewing:APOBEC3G Antibody - N-terminal region (ARP33540_T100)
Your Rating