Loading...
Catalog No: ARP33540_T100
Price: $0.00
SKU
ARP33540_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-APOBEC3G (ARP33540_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3G
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Pig: 79%
Peptide SequenceSynthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC
Concentration1.0 mg/ml
Blocking PeptideFor anti-APOBEC3G (ARP33540_T100) antibody is Catalog # AAP33540
Sample Type Confirmation

APOBEC3G is strongly supported by BioGPS gene expression data to be expressed in Daudi

ReferenceRose,K.M., et al., (2004) J. Biol. Chem. 279 (40), 41744-41749
Publications

Chen, H., Wang, L.-W., Huang, Y.-Q. & Gong, Z.-J. Interferon-alpha Induces High Expression of APOBEC3G and STAT-1 in Vitro and in Vivo. Int. J. Mol. Sci. 11, 3501-12 (2010). 20957108

Gene SymbolAPOBEC3G
Gene Full NameApolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
Alias SymbolsA3G, ARCD, ARP9, ARP-9, CEM15, CEM-15, MDS019, bK150C2.7, dJ494G10.1
NCBI Gene Id60489
Protein NameDNA dC->dU-editing enzyme APOBEC-3G
Description of TargetAnti-APOBEC3G is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity.
Uniprot IDQ9HC16
Protein Accession #NP_068594
Nucleotide Accession #NM_021822
Protein Size (# AA)384
Molecular Weight46kDa
Protein Interactionsvpr; vif; UNG1; APP; UBC; CBFB; APOBEC3G; HSPA4; gag; PTN; PRKACA; UBA52;
  1. What is the species homology for "APOBEC3G Antibody - N-terminal region (ARP33540_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Pig".

  2. How long will it take to receive "APOBEC3G Antibody - N-terminal region (ARP33540_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "APOBEC3G Antibody - N-terminal region (ARP33540_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "APOBEC3G Antibody - N-terminal region (ARP33540_T100)"?

    This target may also be called "A3G, ARCD, ARP9, ARP-9, CEM15, CEM-15, MDS019, bK150C2.7, dJ494G10.1" in publications.

  5. What is the shipping cost for "APOBEC3G Antibody - N-terminal region (ARP33540_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "APOBEC3G Antibody - N-terminal region (ARP33540_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "APOBEC3G Antibody - N-terminal region (ARP33540_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "APOBEC3G Antibody - N-terminal region (ARP33540_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "APOBEC3G"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "APOBEC3G"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "APOBEC3G"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "APOBEC3G"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "APOBEC3G"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "APOBEC3G"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:APOBEC3G Antibody - N-terminal region (ARP33540_T100)
Your Rating
We found other products you might like!