Search Antibody, Protein, and ELISA Kit Solutions

APOBEC3G Antibody - N-terminal region (ARP33540_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33540_T100-FITC Conjugated

ARP33540_T100-HRP Conjugated

ARP33540_T100-Biotin Conjugated

Gene Symbol:
APOBEC3G
Official Gene Full Name:
Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
NCBI Gene Id:
60489
Protein Name:
DNA dC->dU-editing enzyme APOBEC-3G
Swissprot Id:
Q9HC16
Protein Accession #:
NP_068594
Nucleotide Accession #:
NM_021822
Alias Symbols:
ARCD, ARP9, ARP-9, CEM15, CEM-15, MDS019, bK150C2.7, dJ494G10.1
Replacement Item:
This antibody may replace item sc-130689 from Santa Cruz Biotechnology.
Description of Target:
Anti-APOBEC3G is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity.
Protein Size (# AA):
384
Molecular Weight:
46kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express APOBEC3G.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express APOBEC3G.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3G
Predicted Species Reactivity:
Human, Pig
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 79%
Complete computational species homology data:
Anti-APOBEC3G (ARP33540_T100)
Peptide Sequence:
Synthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
vpr; vif; UNG1; APP; UBC; CBFB; APOBEC3G; HSPA4; gag; PTN; PRKACA; UBA52;
Blocking Peptide:
For anti-APOBEC3G (ARP33540_T100) antibody is Catalog # AAP33540
Datasheets/Manuals:
Printable datasheet for anti-APOBEC3G (ARP33540_T100) antibody
Sample Type Confirmation:

APOBEC3G is strongly supported by BioGPS gene expression data to be expressed in Daudi

Target Reference:
Rose,K.M., et al., (2004) J. Biol. Chem. 279 (40), 41744-41749
Publications:

Chen, H., Wang, L.-W., Huang, Y.-Q. & Gong, Z.-J. Interferon-alpha Induces High Expression of APOBEC3G and STAT-1 in Vitro and in Vivo. Int. J. Mol. Sci. 11, 3501-12 (2010). WB, Human, Pig 20957108

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...