Search Antibody, Protein, and ELISA Kit Solutions

APOBEC3A Antibody - C-terminal region (ARP61579_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP61579_P050-FITC Conjugated

ARP61579_P050-HRP Conjugated

ARP61579_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
APOBEC3A
Official Gene Full Name:
APOBEC3A and APOBEC3B deletion hybrid
NCBI Gene Id:
100913187
Protein Name:
probable DNA dC->dU-editing enzyme APOBEC-3A
Swissprot Id:
P31941
Protein Accession #:
XP_005277017
Alias Symbols:
A3A, APOBEC3A
Description of Target:
This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. The protein encoded by this gene lacks the zinc binding activity of other family members. The protein plays a role in immunity, by restricting transmission of foreign DNA such as viruses. One mechanism of foreign DNA restriction is deamination of foreign double-stranded DNA cytidines to uridines, which leads to DNA degradation. However, other mechanisms are also thought to be involved, as anti-viral effect is not dependent on deaminase activity. The protein encoded by this gene is the same as that encoded by APOBEC3A; however, this gene is a hybrid gene that results from the deletion of approximately 29.5 kb of sequence between the APOBEC3A gene and the adjacent gene APOBEC3B. The breakpoints of the deletion are within the two genes, so the deletion hybrid is predicted to have the promoter and coding region of APOBEC3A, but the 3' UTR of APOBEC3B.
Protein Size (# AA):
199
Molecular Weight:
21kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express APOBEC3A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express APOBEC3A.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ABC3A
Predicted Species Reactivity:
Human, Pig
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 100%
Complete computational species homology data:
Anti-APOBEC3A (ARP61579_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-APOBEC3A (ARP61579_P050) antibody is Catalog # AAP61579
Datasheets/Manuals:
Printable datasheet for anti-APOBEC3A (ARP61579_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...