APH1A Antibody - C-terminal region (OABB01904)

Catalog No: OABB01904

Size:100UG

Anti-APH1a Picoband antibody, OABB01904, Western blotting
All lanes: Anti APH1a (OABB01904) at 0.5ug/ml
Lane 1: Mouse Lung Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: SW620 Whole Cell Lysate at 40ug
Lane 4: SMMC Whole Cell Lysate at 40ug
Lane 5: Human Placenta Tissue Lysate at 50ug
Predicted bind size: 29KD
Observed bind size: 29KD

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Hamster|Human|Mouse
• Product Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Clonality: Polyclonal
• Clone: Polyclonal
• Isotype: Rabbit IgG
• Host: Rabbit
• Application: Western blot
• Additional Information: Notes: WB: The detection limit for APH1a is approximately 0.1ng/lane under reducing conditions.
  Tested Species: In-house tested species with positive results.
  Other applications have not been tested.
  Optimal dilutions should be determined by end users.
  Background: APH1a encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants.
• Reconstitution and Storage: 2°C to 8°C|-20°C
• Immunogen: Polypeptide
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: LRSIQRSLLCRRQEDSRVMVYSALRIPPED
• Concentration: 500 ug/ml
• Specificity: No cross reactivity with other proteins.
• Application Info: Western blot: 0.1-0.5 ug/ml: Human, Mouse
• Reference: 1. Qin W; Jia L; Zhou A; Zuo X; Cheng Z; Wang F; Shi F; Jia J: The -980C/G polymorphism in APH-1A promoter confers risk of Alzheimer's disease. Aging Cell, 2011 Aug.
• Storage Buffer: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Description: Rabbit IgG polyclonal antibody for Gamma-secretase subunit APH-1A(APH1A) detection. Tested with WB in Human;Mouse.

Target Info

• Gene Symbol: APH1A
• Gene Full Name: aph-1 homolog A, gamma-secretase subunit
• Alias Symbols: 6530402N02Rik;anterior pharynx defective 1 homolog A;APH-1;APH-1A;APH1A gamma secretase subunit;aph-1alpha;CGI-78;gamma-secretase subunit APH-1A;presenilin-stabilization factor.
• NCBI Gene Id: 51107
• Protein Name: Gamma-secretase subunit APH-1A
• Description of Target: Non-catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein) (PubMed:12297508, PubMed:12522139, PubMed:12763021, PubMed:12679784, PubMed:25043039, PubMed:26280335). Required for normal gamma-secretase assembly (PubMed:12522139, PubMed:12471034, PubMed:12763021, PubMed:19369254). The gamma-secretase complex plays a role in Notch and Wnt signaling cascades and regulation of downstream processes via its role in processing key regulatory proteins, and by regulating cytosolic CTNNB1 levels (Probable).
• Uniprot ID: Q96BI3
• Molecular Weight: 28996 MW