APEX2 Antibody - C-terminal region (ARP65215_P050)

Catalog No: ARP65215_P050

Host: Rabbit
Target Name: APEX2
Sample Tissue: Human Testicular Tumor lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human APEX2
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Horse: 93%; Human: 100%; Rat: 77%
• Peptide Sequence: Synthetic peptide located within the following region: LMTPKTPEEKAVAKVVKGQAKTSEAKDEKELRTSFWKSVLAGPLRTPLCG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-APEX2 (ARP65215_P050) antibody is Catalog # AAP65215

Target Info

• Gene Symbol: APEX2
• Gene Full Name: apurinic/apyrimidinic endodeoxyribonuclease 2
• Alias Symbols: APE2, XTH2, ZGRF2, APEXL2
• NCBI Gene Id: 27301
• Protein Name: DNA-(apurinic or apyrimidinic site) lyase 2
• Description of Target: Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes a protein shown to have a weak class II AP endonuclease activity. Most of the encoded protein is located in the nucleus but some is also present in mitochondria. This protein may play an important role in both nuclear and mitochondrial base excision repair. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Uniprot ID: Q9UBZ4
• Protein Accession #: NP_055296
• Nucleotide Accession #: NM_014481.3
• Protein Size (# AA): 518
• Molecular Weight: 57 kDa
• Protein Interactions: UBC; PDE12; APP; NEDD4L; CCDC85B; NINL; HOOK2; PGR; CALCOCO2; TRIM37; EFEMP2; TRAF2; PCNA;