Search Antibody, Protein, and ELISA Kit Solutions

APCS Antibody - N-terminal region (ARP41962_T100)

100 ul

Regular Price: $249.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP41962_T100-FITC Conjugated

ARP41962_T100-HRP Conjugated

ARP41962_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Guinea Pig, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-18309 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human APCS
Purification:
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 86%; Human: 100%; Mouse: 77%; Rat: 93%
Complete computational species homology data:
Anti-APCS (ARP41962_T100)
Peptide Sequence:
Synthetic peptide located within the following region: NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-APCS (ARP41962_T100) antibody is Catalog # AAP41962 (Previous Catalog # AAPS11103)
Datasheets/Manuals:
Printable datasheet for anti-APCS (ARP41962_T100) antibody
Target Reference:
Veerhuis,R., Neurobiol. Dis. 19 (1-2), 273-282 (2005)
Gene Symbol:
APCS
Official Gene Full Name:
Amyloid P component, serum
Alias Symbols:
MGC88159, PTX2, SAP
NCBI Gene Id:
325
Protein Name:
Serum amyloid P-component
Description of Target:
APCS is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo.The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. This gene has multiple polyadenylation sites.
Swissprot Id:
P02743
Protein Accession #:
NP_001630
Nucleotide Accession #:
NM_001639
Protein Size (# AA):
223
Molecular Weight:
25kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express APCS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express APCS.
Protein Interactions:
COPS5; GK; HES1; GRB2; GOT2; FCGR3B; FCGR2B; CALU; TG; LAMA1; FCGR1A; FCGR3A; FN1; CRP; C4BPA; C1QA; COL4A1; APCS;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...