Now Offering Over 102,157 Antibodies & 44,722 Antigens!

APCS antibody - N-terminal region (ARP41962_T100)

100 ul
$249.00
In Stock

Conjugation Options

ARP41962_T100-FITC Conjugated

ARP41962_T100-HRP Conjugated

ARP41962_T100-Biotin Conjugated

Gene Symbol:
APCS
NCBI Gene Id:
325
Official Gene Full Name:
Amyloid P component, serum
Protein Name:
Serum amyloid P-component
Swissprot Id:
P02743
Protein Accession #:
NP_001630
Nucleotide Accession #:
NM_001639
Alias Symbols:
MGC88159, PTX2, SAP
Replacement Item:
This antibody may replace item sc-18309 from Santa Cruz Biotechnology.
Description of Target:
APCS is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo.The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. This gene has multiple polyadenylation sites.
Protein Size (# AA):
223
Molecular Weight:
25kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express APCS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express APCS.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human APCS
Species Reactivity:
Guinea Pig, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 86%; Human: 100%; Mouse: 77%; Rat: 93%
Complete computational species homology data:
Anti-APCS (ARP41962_T100)
Peptide Sequence:
Synthetic peptide located within the following region: NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
COPS5; GK; HES1; GRB2; GOT2; FCGR3B; FCGR2B; CALU; TG; LAMA1; FCGR1A; FCGR3A; FN1; CRP; C4BPA; C1QA; COL4A1; APCS;
Blocking Peptide:
For anti-APCS (ARP41962_T100) antibody is Catalog # AAP41962 (Previous Catalog # AAPS11103)
Datasheets/Manuals:
Printable datasheet for anti-APCS (ARP41962_T100) antibody
Target Reference:
Veerhuis,R., Neurobiol. Dis. 19 (1-2), 273-282 (2005)

Tell us what you think about this item!

Write A Review
    Please, wait...