Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
SKU
ARP41962_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41962_T100-FITC Conjugated

ARP41962_T100-HRP Conjugated

ARP41962_T100-Biotin Conjugated

APCS Antibody - N-terminal region (ARP41962_T100)

Catalog#: ARP41962_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Guinea Pig, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-18309 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human APCS
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Guinea Pig: 86%; Human: 100%; Mouse: 77%; Rat: 93%
Complete computational species homology data Anti-APCS (ARP41962_T100)
Peptide Sequence Synthetic peptide located within the following region: NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-APCS (ARP41962_T100) antibody is Catalog # AAP41962 (Previous Catalog # AAPS11103)
Datasheets/Manuals Printable datasheet for anti-APCS (ARP41962_T100) antibody
Target Reference Veerhuis,R., Neurobiol. Dis. 19 (1-2), 273-282 (2005)
Gene Symbol APCS
Official Gene Full Name Amyloid P component, serum
Alias Symbols MGC88159, PTX2, SAP
NCBI Gene Id 325
Protein Name Serum amyloid P-component
Description of Target APCS is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo.The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. This gene has multiple polyadenylation sites.
Swissprot Id P02743
Protein Accession # NP_001630
Nucleotide Accession # NM_001639
Protein Size (# AA) 223
Molecular Weight 25kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express APCS.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express APCS.
Protein Interactions COPS5; GK; HES1; GRB2; GOT2; FCGR3B; FCGR2B; CALU; TG; LAMA1; FCGR1A; FCGR3A; FN1; CRP; C4BPA; C1QA; COL4A1; APCS;
  1. What is the species homology for "APCS Antibody - N-terminal region (ARP41962_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Guinea Pig, Human, Mouse, Rat".

  2. How long will it take to receive "APCS Antibody - N-terminal region (ARP41962_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "APCS Antibody - N-terminal region (ARP41962_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "APCS Antibody - N-terminal region (ARP41962_T100)"?

    This target may also be called "MGC88159, PTX2, SAP" in publications.

  5. What is the shipping cost for "APCS Antibody - N-terminal region (ARP41962_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "APCS Antibody - N-terminal region (ARP41962_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "APCS Antibody - N-terminal region (ARP41962_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "25kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "APCS Antibody - N-terminal region (ARP41962_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "APCS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "APCS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "APCS"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "APCS"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "APCS"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "APCS"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:APCS Antibody - N-terminal region (ARP41962_T100)
Your Rating
We found other products you might like!