Apbb1 Antibody - N-terminal region (ARP55471_P050)

Catalog No: ARP55471_P050

WB Suggested Anti-Apbb1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Mouse Heart

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Apbb1 (ARP55471_P050) antibody is Catalog # AAP55471 (Previous Catalog # AAPP33363)

Target Info

• Gene Symbol: Apbb1
• Gene Full Name: Amyloid beta (A4) precursor protein-binding, family B, member 1
• Alias Symbols: Rir, Fe65
• NCBI Gene Id: 11785
• Protein Name: Amyloid beta A4 precursor protein-binding family B member 1
• Description of Target: Apbb1 is an adapter protein that forms a transcriptionally active complex with the gamma-secretase-derived amyloid precursor protein (APP) intracellular domain.Apbb1 plays a central role in the response to DNA damage by translocating to the nucleus and inducing apoptosis. Apbb1 may act by specifically recognizing and binding histone H2AX phosphorylated on 'Tyr-142' (H2AXY142ph) at double-strand breaks (DSBs), recruiting other pro-apoptosis factors such as MAPK8/JNK1. Apbb1 is required for histone H4 acetylation at double-strand breaks (DSBs). Its ability to specifically bind modified histones and chromatin modifying enzymes such as KAT5/TIP60, probably explains its trancription activation activity.Apbb1 functions in association with TSHZ3, SET and HDAC factors as a transcriptional repressor, that inhibits the expression of CASP4. Apbb1 is associates with chromatin in a region surrounding the CASP4 transcriptional start site(s).
• Uniprot ID: Q9QXJ1
• Protein Accession #: NP_033815
• Nucleotide Accession #: NM_009685
• Protein Size (# AA): 708
• Molecular Weight: 78kDa
• Protein Interactions: Rnf157; Enah; Prnp; APP; APLP2; APLP1; Evl;