Search Antibody, Protein, and ELISA Kit Solutions

Ap3b1 Antibody - N-terminal region : Biotin (ARP33647_P050-Biotin)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33647_P050 Unconjugated

ARP33647_P050-FITC Conjugated

ARP33647_P050-HRP Conjugated

Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
Biotin
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
Ap3b1
Official Gene Full Name:
Adaptor-related protein complex 3, beta 1 subunit
NCBI Gene Id:
309969
Protein Name:
Adaptor-related protein complex 3, beta 1 subunit (Predicted), isoform CRA_a EMBL EDM10075.1
Swissprot Id:
D4AA25
Protein Accession #:
EDM10075
Nucleotide Accession #:
NM_001107646
Alias Symbols:
Ap3b1
Replacement Item:
This antibody may replace item sc-114819 from Santa Cruz Biotechnology.
Description of Target:
The function of Ap3b1 remains unknown.
Protein Size (# AA):
1096
Molecular Weight:
121kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ap3b1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ap3b1.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 79%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93%
Complete computational species homology data:
Anti-Ap3b1 (ARP33647_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-Ap3b1 (ARP33647_P050-Biotin) antibody is Catalog # AAP33647 (Previous Catalog # AAPP04709)
Datasheets/Manuals:
Printable datasheet for anti-Ap3b1 (ARP33647_P050-Biotin) antibody
Subunit:
beta-1

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...