Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP33647_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33647_P050-FITC Conjugated

ARP33647_P050-HRP Conjugated

ARP33647_P050-Biotin Conjugated

Ap3b1 Antibody - N-terminal region (ARP33647_P050)

Catalog#: ARP33647_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Rat
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-114819 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide corresponding to a region of Rat
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 79%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93%
Complete computational species homology data Anti-Ap3b1 (ARP33647_P050)
Peptide Sequence Synthetic peptide located within the following region: MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Ap3b1 (ARP33647_P050) antibody is Catalog # AAP33647 (Previous Catalog # AAPP04709)
Datasheets/Manuals Printable datasheet for anti-Ap3b1 (ARP33647_P050) antibody
Subunit beta-1
Publications

Kuwahara, T; Inoue, K; D'Agati, VD; Fujimoto, T; Eguchi, T; Saha, S; Wolozin, B; Iwatsubo, T; Abeliovich, A; LRRK2 and RAB7L1 coordinately regulate axonal morphology and lysosome integrity in diverse cellular contexts. 6, 29945 (2016). WB, Cow, Dog, Horse, Human, Mouse, Pig 27424887

Gene Symbol Ap3b1
Official Gene Full Name Adaptor-related protein complex 3, beta 1 subunit
Alias Symbols Ap3b1
NCBI Gene Id 309969
Protein Name Adaptor-related protein complex 3, beta 1 subunit (Predicted), isoform CRA_a EMBL EDM10075.1
Description of Target The function of Ap3b1 remains unknown.
Swissprot Id D4AA25
Protein Accession # EDM10075
Nucleotide Accession # NM_001107646
Protein Size (# AA) 1096
Molecular Weight 121kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Ap3b1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Ap3b1.
Write Your Own Review
You're reviewing:Ap3b1 Antibody - N-terminal region (ARP33647_P050)
Your Rating