Search Antibody, Protein, and ELISA Kit Solutions

Ap3b1 antibody - N-terminal region (ARP33647_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33647_P050-FITC Conjugated

ARP33647_P050-HRP Conjugated

ARP33647_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Adaptor-related protein complex 3, beta 1 subunit
Protein Name:
Adaptor-related protein complex 3, beta 1 subunit (Predicted), isoform CRA_a EMBL EDM10075.1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-114819 from Santa Cruz Biotechnology.
Description of Target:
The function of Ap3b1 remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ap3b1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ap3b1.
The immunogen is a synthetic peptide corresponding to a region of Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 79%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93%
Complete computational species homology data:
Anti-Ap3b1 (ARP33647_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Ap3b1 (ARP33647_P050) antibody is Catalog # AAP33647 (Previous Catalog # AAPP04709)
Printable datasheet for anti-Ap3b1 (ARP33647_P050) antibody

Kuwahara, T; Inoue, K; D'Agati, VD; Fujimoto, T; Eguchi, T; Saha, S; Wolozin, B; Iwatsubo, T; Abeliovich, A; LRRK2 and RAB7L1 coordinately regulate axonal morphology and lysosome integrity in diverse cellular contexts. 6, 29945 (2016). WB, Cow, Dog, Horse, Human, Mouse, Pig 27424887

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...