Search Antibody, Protein, and ELISA Kit Solutions

Ap3b1 Antibody - N-terminal region (ARP33647_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP33647_P050-FITC Conjugated

ARP33647_P050-HRP Conjugated

ARP33647_P050-Biotin Conjugated

Tested Species Reactivity:
Rat
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-114819 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Rat
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 79%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93%
Complete computational species homology data:
Anti-Ap3b1 (ARP33647_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Ap3b1 (ARP33647_P050) antibody is Catalog # AAP33647 (Previous Catalog # AAPP04709)
Datasheets/Manuals:
Printable datasheet for anti-Ap3b1 (ARP33647_P050) antibody
Subunit:
beta-1
Publications:

Kuwahara, T; Inoue, K; D'Agati, VD; Fujimoto, T; Eguchi, T; Saha, S; Wolozin, B; Iwatsubo, T; Abeliovich, A; LRRK2 and RAB7L1 coordinately regulate axonal morphology and lysosome integrity in diverse cellular contexts. 6, 29945 (2016). WB, Cow, Dog, Horse, Human, Mouse, Pig 27424887

Gene Symbol:
Ap3b1
Official Gene Full Name:
Adaptor-related protein complex 3, beta 1 subunit
Alias Symbols:
Ap3b1
NCBI Gene Id:
309969
Protein Name:
Adaptor-related protein complex 3, beta 1 subunit (Predicted), isoform CRA_a EMBL EDM10075.1
Description of Target:
The function of Ap3b1 remains unknown.
Swissprot Id:
D4AA25
Protein Accession #:
EDM10075
Nucleotide Accession #:
NM_001107646
Protein Size (# AA):
1096
Molecular Weight:
121kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ap3b1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ap3b1.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...