SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP73908_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP73908_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

AP1S2 Antibody - C-terminal region : FITC (ARP73908_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-AP1S2 (ARP73908_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human AP1S2
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: YFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQE
Concentration0.5 mg/ml
Blocking PeptideFor anti-AP1S2 (ARP73908_P050-FITC) antibody is Catalog # AAP73908
Gene SymbolAP1S2
Alias SymbolsPGS, DC22, MRX59, MRXS5, MRXSF, MRXS21, SIGMA1B
NCBI Gene Id8905
Description of TargetAdaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as the small subunit of this complex and is a member of the adaptin protein family. Transcript variants encoding different isoforms have been found for this gene.
Uniprot IDP56377
Protein Size (# AA)157
Molecular Weight17kDa
Protein InteractionsAP1G1; EGFR; AP1M1; AP1B1; ELAVL1; UBC; GGA3; AP1G2;
  1. What is the species homology for "AP1S2 Antibody - C-terminal region : FITC (ARP73908_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "AP1S2 Antibody - C-terminal region : FITC (ARP73908_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AP1S2 Antibody - C-terminal region : FITC (ARP73908_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AP1S2 Antibody - C-terminal region : FITC (ARP73908_P050-FITC)"?

    This target may also be called "PGS, DC22, MRX59, MRXS5, MRXSF, MRXS21, SIGMA1B" in publications.

  5. What is the shipping cost for "AP1S2 Antibody - C-terminal region : FITC (ARP73908_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AP1S2 Antibody - C-terminal region : FITC (ARP73908_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AP1S2 Antibody - C-terminal region : FITC (ARP73908_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "17kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AP1S2 Antibody - C-terminal region : FITC (ARP73908_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AP1S2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AP1S2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AP1S2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AP1S2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AP1S2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AP1S2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AP1S2 Antibody - C-terminal region : FITC (ARP73908_P050-FITC)
Your Rating
We found other products you might like!