AOC2 Antibody - middle region (ARP45057_P050)

Catalog No: ARP45057_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-AOC2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Lung

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AOC2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 82%
• Peptide Sequence: Synthetic peptide located within the following region: AEDIPNTVTLGNRVGFLLRPYNFFDEDPSIFSPGSVYFEKGQDAGLCSIN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AOC2 (ARP45057_P050) antibody is Catalog # AAP45057 (Previous Catalog # AAPP12345)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Zhang,Q., Gene 318, 45-53 (2003)

Target Info

• Gene Symbol: AOC2
• Gene Full Name: Amine oxidase, copper containing 2 (retina-specific)
• Alias Symbols: RAO, DAO2, SSAO
• NCBI Gene Id: 314
• Protein Name: Retina-specific copper amine oxidase
• Description of Target: Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes and ammonia in the presence of copper and quinone cofactor. The protein contains several conserved motifs including the active site of amine oxidases and the histidine residues that likely bind copper. It may be a critical modulator of signal transmission in retina, possibly by degrading the biogenic amines dopamine, histamine, and putrescine. Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes and ammonia in the presence of copper and quinone cofactor. This gene shows high sequence similarity to copper amine oxidases from various species ranging from bacteria to mammals. The protein contains several conserved motifs including the active site of amine oxidases and the histidine residues that likely bind copper. It may be a critical modulator of signal transmission in retina, possibly by degrading the biogenic amines dopamine, histamine, and putrescine. This gene may be a candidate gene for hereditary ocular diseases. Alternate splicing results in multiple transcript variants.
• Uniprot ID: O75106
• Protein Accession #: NP_033720
• Nucleotide Accession #: NM_009590
• Protein Size (# AA): 756
• Molecular Weight: 84kDa