ANXA9 Antibody - middle region (ARP85728_P050)

Catalog No: ARP85728_P050

Host: Rabbit
Target Name: ANXA9
Sample Tissue: Human HT1080 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ANXA9
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: SAIVDVLTNRSREQRQLISRNFQERTQQDLMKSLQAALSGNLERIVMALL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ANXA9 (ARP85728_P050) antibody is Catalog # AAP85728

Target Info

• Gene Symbol: ANXA9
• Gene Full Name: annexin A9
• Alias Symbols: ANX31
• NCBI Gene Id: 8416
• Protein Name: annexin A9
• Description of Target: The annexins are a family of calcium-dependent phospholipid-binding proteins. Members of the annexin family contain 4 internal repeat domains, each of which includes a type II calcium-binding site. The calcium-binding sites are required for annexins to aggregate and cooperatively bind anionic phospholipids and extracellular matrix proteins. This gene encodes a divergent member of the annexin protein family in which all four homologous type II calcium-binding sites in the conserved tetrad core contain amino acid substitutions that ablate their function. However, structural analysis suggests that the conserved putative ion channel formed by the tetrad core is intact.
• Uniprot ID: O76027
• Protein Accession #: NP_003559.2
• Nucleotide Accession #: NM_003568.2
• Protein Size (# AA): 345
• Molecular Weight: 37 kDa