Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

ANXA4 Antibody - N-terminal region (ARP36686_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36686_T100-FITC Conjugated

ARP36686_T100-HRP Conjugated

ARP36686_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Annexin A4
NCBI Gene Id:
Protein Name:
Annexin RuleBase RU003540
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ANX4, PIG28, ZAP36
Replacement Item:
This antibody may replace item sc-135831 from Santa Cruz Biotechnology.
Description of Target:
Annexin A4 (ANXA4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANXA4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANXA4 is almost exclusively expressed in epithelial cells.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ANXA4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ANXA4.
The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA4
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-ANXA4 (ARP36686_T100)
Peptide Sequence:
Synthetic peptide located within the following region: GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ANXA4 (ARP36686_T100) antibody is Catalog # AAP36686 (Previous Catalog # AAPP08113)
Printable datasheet for anti-ANXA4 (ARP36686_T100) antibody
Target Reference:
Zimmermann,U., et al., (2004) Cancer Lett. 209 (1), 111-118

de la Cuesta, F. et al. A proteomic focus on the alterations occurring at the human atherosclerotic coronary intima. Mol. Cell. Proteomics 10, M110.003517 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 21248247

Staquicini, F. I. et al. Vascular ligand-receptor mapping by direct combinatorial selection in cancer patients. Proc. Natl. Acad. Sci. U. S. A. 108, 18637-42 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22049339

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...