Size:100 ul
$249.00
In Stock
SKU
ARP36686_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36686_T100-FITC Conjugated

ARP36686_T100-HRP Conjugated

ARP36686_T100-Biotin Conjugated

ANXA4 Antibody - N-terminal region (ARP36686_T100)

Catalog#: ARP36686_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Rat
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-135831 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA4
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data Anti-ANXA4 (ARP36686_T100)
Peptide Sequence Synthetic peptide located within the following region: GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ANXA4 (ARP36686_T100) antibody is Catalog # AAP36686 (Previous Catalog # AAPP08113)
Datasheets/Manuals Printable datasheet for anti-ANXA4 (ARP36686_T100) antibody
Target Reference Zimmermann,U., et al., (2004) Cancer Lett. 209 (1), 111-118
Publications

de la Cuesta, F. et al. A proteomic focus on the alterations occurring at the human atherosclerotic coronary intima. Mol. Cell. Proteomics 10, M110.003517 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 21248247

Staquicini, F. I. et al. Vascular ligand-receptor mapping by direct combinatorial selection in cancer patients. Proc. Natl. Acad. Sci. U. S. A. 108, 18637-42 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22049339

Gene Symbol ANXA4
Official Gene Full Name Annexin A4
Alias Symbols ANX4, PIG28, ZAP36
NCBI Gene Id 307
Protein Name Annexin RuleBase RU003540
Description of Target Annexin A4 (ANXA4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANXA4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANXA4 is almost exclusively expressed in epithelial cells.
Swissprot Id Q6LES2
Protein Accession # NP_001144
Nucleotide Accession # NM_001153
Protein Size (# AA) 321
Molecular Weight 35kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ANXA4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ANXA4.
Protein Interactions PADI4; UBC; EZH2; DNAJB11; MPST; ANXA7; ANXA3; ANXA1; TINF2; POT1; SUMO2; NMT2; SMPD1; Cdk1; UCHL5; H2AFX; NFKB1; GP2;
  1. What is the species homology for "ANXA4 Antibody - N-terminal region (ARP36686_T100)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "ANXA4 Antibody - N-terminal region (ARP36686_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ANXA4 Antibody - N-terminal region (ARP36686_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ANXA4 Antibody - N-terminal region (ARP36686_T100)"?

    This target may also be called "ANX4, PIG28, ZAP36" in publications.

  5. What is the shipping cost for "ANXA4 Antibody - N-terminal region (ARP36686_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ANXA4 Antibody - N-terminal region (ARP36686_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ANXA4 Antibody - N-terminal region (ARP36686_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ANXA4 Antibody - N-terminal region (ARP36686_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ANXA4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ANXA4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ANXA4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ANXA4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ANXA4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ANXA4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ANXA4 Antibody - N-terminal region (ARP36686_T100)
Your Rating
We found other products you might like!