ANO7 Antibody - middle region (ARP93767_P050)

Catalog No: ARP93767_P050

Host: Rabbit
Target Name: ANO7
Sample Tissue: Rat Liver lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Rat
• Predicted Species Reactivity: Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of rat ANO7
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: EHVPDTPPEYYSCQFKASKLQWFLGSDNQDTFFTSTKRHQILFEILAKTP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ANO7 (ARP93767_P050) antibody is Catalog # AAP93767

Target Info

• Gene Symbol: ANO7
• Gene Full Name: anoctamin 7
• Alias Symbols: NG, Pc, IPC, NGE, Ngep, Ngep-L, Pcanap5, Tmem16g
• NCBI Gene Id: 404545
• Protein Name: anoctamin-7
• Description of Target: This gene encodes a member of the anoctamin family, which in mammals is comprised of 10 members. Anoctamin proteins are proposed to have eight transmembrane domains with both termini facing the cytoplasm and a C-terminal domain of unknown function. While some members have been characterized as calcium-activated chloride channels, this protein is reported to have little anion conductance activity. In humans, this protein is primarily found in prostate tissues and may serve as a target for prostate cancer immunotherapy. Alternative splicing results in multiple transcript variants that encode different isoforms.
• Uniprot ID: Q6IFT6
• Protein Accession #: NP_001258813.1
• Nucleotide Accession #: NM_001271884.1
• Protein Size (# AA): 860
• Molecular Weight: 94 kDa