Search Antibody, Protein, and ELISA Kit Solutions

ANO6 Antibody -C-terminal region : HRP (ARP44761_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44761_P050 Unconjugated

ARP44761_P050-FITC Conjugated

ARP44761_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
HRP
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
ANO6
Official Gene Full Name:
Anoctamin 6
NCBI Gene Id:
196527
Protein Name:
Anoctamin-6
Swissprot Id:
Q4KMQ2
Protein Accession #:
NP_001020527
Nucleotide Accession #:
NM_001025356
Alias Symbols:
MGC104751, SCTS, BDPLT7, TMEM16F
Description of Target:
TMEM16F may act as a calcium-activated chloride channel.
Protein Size (# AA):
910
Molecular Weight:
106kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ANO6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ANO6.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of human ANO6
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-ANO6 (ARP44761_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV
Concentration:
0.5 mg/ml
Protein Interactions:
UBC; ELAVL1;
Blocking Peptide:
For anti-ANO6 (ARP44761_P050-HRP) antibody is Catalog # AAP44761 (Previous Catalog # AAPP12410)
Datasheets/Manuals:
Printable datasheet for anti-ANO6 (ARP44761_P050-HRP) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...