Search Antibody, Protein, and ELISA Kit Solutions

ANO6 Antibody -C-terminal region (ARP44761_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44761_P050-FITC Conjugated

ARP44761_P050-HRP Conjugated

ARP44761_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ANO6
Official Gene Full Name:
Anoctamin 6
NCBI Gene Id:
196527
Protein Name:
Anoctamin-6
Swissprot Id:
Q4KMQ2
Protein Accession #:
NP_001020527
Nucleotide Accession #:
NM_001025356
Alias Symbols:
MGC104751, SCTS, BDPLT7, TMEM16F
Description of Target:
TMEM16F may act as a calcium-activated chloride channel.
Protein Size (# AA):
910
Molecular Weight:
106kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ANO6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ANO6.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of human ANO6
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-ANO6 (ARP44761_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; ELAVL1;
Blocking Peptide:
For anti-ANO6 (ARP44761_P050) antibody is Catalog # AAP44761 (Previous Catalog # AAPP12410)
Datasheets/Manuals:
Printable datasheet for anti-ANO6 (ARP44761_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...