Search Antibody, Protein, and ELISA Kit Solutions

ANO1 Antibody - C-terminal region : FITC (ARP72448_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72448_P050 Unconjugated

ARP72448_P050-HRP Conjugated

ARP72448_P050-Biotin Conjugated

Gene Symbol:
ANO1
NCBI Gene Id:
55107
Swissprot Id:
Q5XXA6
Protein Accession #:
NP_060513
Alias Symbols:
ANO1, DOG1, ORAOV2, TAOS2, TMEM16A,
Replacement Item:
This antibody may replace item sc-135235 from Santa Cruz Biotechnology.
Description of Target:
ANO1 is a calcium-activated chloride channel (CaCC) which plays a role in transepithelial anion transport and smooth muscle contraction. It is required for the normal functioning of the interstitial cells of Cajal (ICCs) which generate electrical pacemaker activity in gastrointestinal smooth muscles. It acts as a major contributor to basal and stimulated chloride conductance in airway epithelial cells and plays an important role in tracheal cartilage development.
Protein Size (# AA):
986
Molecular Weight:
108kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ANO1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ANO1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANO1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-ANO1 (ARP72448_P050-FITC) antibody is Catalog # AAP72448
Datasheets/Manuals:
Printable datasheet for anti-ANO1 (ARP72448_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...