Search Antibody, Protein, and ELISA Kit Solutions

ANKRD55 Antibody - C-terminal region (ARP68892_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP68892_P050-FITC Conjugated

ARP68892_P050-HRP Conjugated

ARP68892_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Human, Pig, Rabbit
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
NCBI Gene Id:
Protein Name:
Ankyrin repeat domain-containing protein 55
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-244962 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ANKRD55.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ANKRD55.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANKRD55
Predicted Homology Based on Immunogen Sequence:
Cow: 82%; Dog: 91%; Human: 100%; Pig: 91%; Rabbit: 82%
Peptide Sequence:
Synthetic peptide located within the following region: LSQESRTEPTRPPPSQSSRPQKKERRFNVLNQIFCKNKKEEQRAHQKDPS
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ANKRD55 (ARP68892_P050) antibody is Catalog # AAP68892
Printable datasheet for anti-ANKRD55 (ARP68892_P050) antibody

Lopez de Lapuente, A; Feliú, A; Ugidos, N; Mecha, M; Mena, J; Astobiza, I; Riera, J; Carillo-Salinas, F; Comabella, M; Montalban, X; Alloza, I; Guaza, C; Vandenbroeck, K; Novel Insights into the Multiple Sclerosis Risk Gene ANKRD55.. 196, 4553-65 (2016). WB, Cow, Dog, Human, Pig, Rabbit 27183579

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...