Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP68892_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP68892_P050-FITC Conjugated

ARP68892_P050-HRP Conjugated

ARP68892_P050-Biotin Conjugated

ANKRD55 Antibody - C-terminal region (ARP68892_P050)

Catalog#: ARP68892_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Human, Pig, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-244962 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANKRD55
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 82%; Dog: 91%; Human: 100%; Pig: 91%; Rabbit: 82%
Peptide Sequence Synthetic peptide located within the following region: LSQESRTEPTRPPPSQSSRPQKKERRFNVLNQIFCKNKKEEQRAHQKDPS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ANKRD55 (ARP68892_P050) antibody is Catalog # AAP68892
Datasheets/Manuals Printable datasheet for anti-ANKRD55 (ARP68892_P050) antibody
Publications

Lopez de Lapuente, A; Feliú, A; Ugidos, N; Mecha, M; Mena, J; Astobiza, I; Riera, J; Carillo-Salinas, F; Comabella, M; Montalban, X; Alloza, I; Guaza, C; Vandenbroeck, K; Novel Insights into the Multiple Sclerosis Risk Gene ANKRD55.. 196, 4553-65 (2016). WB, Cow, Dog, Human, Pig, Rabbit 27183579

Gene Symbol ANKRD55
Alias Symbols -
NCBI Gene Id 79722
Protein Name Ankyrin repeat domain-containing protein 55
Description of Target The function of this protein remains unknown.
Swissprot Id Q3KP44
Protein Accession # NP_078945
Nucleotide Accession # NM_024669
Protein Size (# AA) 614
Molecular Weight 68kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ANKRD55.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ANKRD55.
Protein Interactions ZSCAN1;
Write Your Own Review
You're reviewing:ANKRD55 Antibody - C-terminal region (ARP68892_P050)
Your Rating