ANKRD39 Antibody - N-terminal region (ARP56912_P050)

Catalog No: ARP56912_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-ANKRD39 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANKRD39
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: IWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ANKRD39 (ARP56912_P050) antibody is Catalog # AAP56912 (Previous Catalog # AAPP44618)

Target Info

• Gene Symbol: ANKRD39
• Gene Full Name: Ankyrin repeat domain 39
• Alias Symbols: MGC41816
• NCBI Gene Id: 51239
• Protein Name: Ankyrin repeat domain-containing protein 39
• Description of Target: The function of ANKRD39 remains unknown.
• Uniprot ID: Q53RE8
• Protein Accession #: NP_057550
• Nucleotide Accession #: NM_016466
• Protein Size (# AA): 183
• Molecular Weight: 20kDa
• Protein Interactions: BAG3; APP; CUL2; CUL3; CUL4B; UBC;