ANKRD28 Antibody - middle region (ARP96978_P050)

Catalog No: ARP96978_P050

Host: Rabbit
Target Name: ANKRD28
Sample Tissue: Human 293T Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ANKRD28
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: IVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ANKRD28 (ARP96978_P050) antibody is Catalog # AAP96978

Target Info

• Gene Symbol: ANKRD28
• Gene Full Name: PITK, PPP1R65
• Alias Symbols: PITK, FAP79, CFAP79, PPP1R65
• NCBI Gene Id: 23243
• Protein Name: Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A
• Description of Target: Putative regulatory subunit of protein phosphatase 6 (PP6) that may be involved in the recognition of phosphoprotein substrates. Involved in the PP6-mediated dephosphorylation of NFKBIE opposing its degradation in response to TNF-alpha. Selectively inhibits the phosphatase activity of PPP1C. Targets PPP1C to modulate HNRPK phosphorylation.
• Uniprot ID: O15084-2
• Protein Accession #: NP_001182027.1
• Nucleotide Accession #: NM_001195098.1
• Protein Size (# AA): 899
• Molecular Weight: 96 kDa