$0.00
In Stock
SKU
OPCA85242
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

ANI_1_1372164 Recombinant Protein (Aspergillus niger) (OPCA85242)

Catalog#: OPCA85242
Domestic: within 4-6 weeks delivery | International: 4-6 weeks
More Information
Predicted Species Reactivity Aspergillus niger
Product Format Liquid
Host E. coli, yeast, insect, or mammalian cell can be selected above to determine price.
Application WB, ELISA
Additional Information For Research Use Only.
Sterile filtering available upon request.
Low endotoxin available upon request.
Reconstitution and Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity Greater than 85% as determined by SDS-PAGE.
Protein Sequence GNVENNHNVCTVRANGGHQDDVPNIMAAFKECGNGGTIIFPEDQSYWIATRLHPTLKDVAIEWRGKWTFSDNLTYWRNNSYPIAFQNHHAGFIISGDNITINGYGTGGIDGNGNTWYTAEKGDTQPGRPMPFVFWNVSEVIVDSFYVKDPPLWSVNIMNGTNMRFNNIYCNATAVDAPWGDNWVQNTDGFDTMDATNIQLTNFVYQGGDDCIAIKPRSYNIDIQNVTCRGGNGIAIGSLGQYLEDSSVANIRVDKVNIIRYNEDMHNSAYLKTWVGALVPQSSYESAGVPRGDGWGSIRNVLFSNFNVQGASAGPSISQDSGDNGSYAGTSKMSISNVAFVNFTGWVDTEKSVVSTVSCSEVHPCYNIDYDNVVLYPGKNATTAGTGSCKYTADGGVHGLSGC
Storage Buffer Tris-based buffer,50% glycerol
Tag This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements.
Datasheets/Manuals Printable datasheet for OPCA85242
Gene Symbol ANI_1_1372164
NCBI Gene Id 4990047
Swissprot Id A2RAY7
Protein Size (# AA) 403
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ANI_1_1372164.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ANI_1_1372164.
Write Your Own Review
You're reviewing:ANI_1_1372164 Recombinant Protein (Aspergillus niger) (OPCA85242)
Your Rating