Search Antibody, Protein, and ELISA Kit Solutions

ANGPTL6 Antibody - C-terminal region (ARP60574_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP60574_P050-FITC Conjugated

ARP60574_P050-HRP Conjugated

ARP60574_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
ANGPTL6
Official Gene Full Name:
angiopoietin-like 6
NCBI Gene Id:
83854
Protein Name:
Angiopoietin-related protein 6
Swissprot Id:
Q8NI99
Protein Accession #:
NP_114123.2
Alias Symbols:
AGF, ARP5
Replacement Item:
This antibody may replace item sc-141062 from Santa Cruz Biotechnology.
Protein Size (# AA):
470
Molecular Weight:
51 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis
Immunogen:
The immunogen for Anti-ANGPTL6 antibody is: synthetic peptide directed towards the C-terminal region of Human ANGL6
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
ARP60574_P050
Peptide Sequence:
Synthetic peptide located within the following region: PESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
XRN1;
Blocking Peptide:
Catalog # AAP60574
Datasheets/Manuals:
Printable datasheet for ARP60574_P050
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...