ANGPTL6 Antibody - C-terminal region (ARP60574_P050)

Catalog No: ARP60574_P050

Host: Rabbit
Target Name: ANGL6
Sample Type: Thymus Tumor
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen for Anti-ANGPTL6 antibody is: synthetic peptide directed towards the C-terminal region of Human ANGL6
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGG
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP60574
• Reference: N/A

Target Info

• Gene Symbol: ANGPTL6
• Gene Full Name: angiopoietin-like 6
• Alias Symbols: AGF, ARP5
• NCBI Gene Id: 83854
• Protein Name: Angiopoietin-related protein 6
• Uniprot ID: Q8NI99
• Protein Accession #: NP_114123.2
• Protein Size (# AA): 470
• Molecular Weight: 51 kDa
• Protein Interactions: XRN1;