Catalog No: OPPA00514 (Formerly GWB-D91E44)
Size:2UG
Price: $75.00
SKU
OPPA00514
Availability: Domestic: within 1-2 weeks delivery | International: 1-2 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
ANGPTL4 Human - Recombinant Human Angiopoietin-like Protein 4 (OPPA00514)
Predicted Species Reactivity | Human |
---|---|
Product Format | Lyophilized 0.05M Acetate buffer (pH 4) Physical Appearance: White freeze-dried powder |
Host | E. Coli |
Reconstitution and Storage | Add 0.2 ml of 0.1M Acetate buffer pH4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 ug/ml. In higher concentrations the solubility of this antigen is limited. Store lyophilized Angiopoietin-like Protein 4 Human recombinant at -20C. Aliquot the ANGPTL4 after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted ANGPTL4 can be stored at 4C for a limited period of time; it does not show any change after two weeks at 4C. |
Purification | One-step procedure using affinity Ni-NTA chromatography. |
Concentration | 0.5 mg/ml (prior to lyophilization) |
Purity | Greater than 95% as determined by SDS-PAGE. |
Specificity | The amino acid sequence of the ANGPTL4 Human recombinant is 100% homologous to the 26-229 amino acid sequence of the Angiopoietin-like Protein-4 precursor without signal sequence. |
Peptide Sequence | MRGSHHHHHHGMASHMGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQR. |
Tag | N-terminal His Tag |
Gene Symbol | ANGPTL4 |
---|---|
Alias Symbols | NL2, ARP4, FIAF, HARP, PGAR, HFARP, TGQTL, UNQ171, pp1158 |
NCBI Gene Id | 51129 |
Protein Name | Angiopoietin-related protein 4 |
Description of Target | FIAF (fasting-induced adipose factor) a.k.a ANGPTL4 or PGAR or HFARP is an adipocytokine up-regulated by fasting, by peroxisome proliferator-activated receptor agonists, and by hypoxia. ANGPTL4 is found in human and mouse blood plasma both as a native protein and in a truncated form. In human white adipose tissue and SGBS adipocytes, only the native form of ANGPTL4 could be detected, whereas in mice the differentiation of mouse 3T3-L1 adipocytes is associated with the production of truncated ANGPTL4. However, the truncated ANGPTL4 is produced by human liver. In human blood plasma FIAF is mainly presented in a truncated form (FIAF-S2), whose levels treatment increases (as shown by experimental data). There is an inter individual variation in ANGPTL4 levels of both the truncated and the native form, however those levels were not influenced by prolonged semistarvation and are not associated with body mass index. |
Uniprot ID | Q9BY76 |
Protein Accession # | NP_001034756.1 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 25 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!