ANGPT1 Antibody - middlel region (ARP89742_P050)

Catalog No: ARP89742_P050

Host: Rabbit
Target Name: ANGPT1
Sample Tissue: Mouse Skeletal Muscle lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse ANGPT1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: IFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ANGPT1 (ARP89742_P050) antibody is Catalog # AAP89742

Target Info

• Gene Symbol: ANGPT1
• Gene Full Name: angiopoietin 1
• Alias Symbols: an, Ang, Ang1, Ang-1, 1110046O21Rik
• NCBI Gene Id: 11600
• Protein Name: angiopoietin-1
• Description of Target: This gene encodes a secreted glycoprotein that belongs to the angiopoietin family of vascular growth factors. The encoded protein is a ligand in the vascular tyrosine kinase signaling pathway and regulates the formation and stabilization of blood vessels. This protein also functions in striated muscles by promoting proliferation, migration and differentiation of skeletal myoblasts and plays an essential role in the vascular response to tissue injury. Alternative splicing results in multiple transcript variants.
• Uniprot ID: O08538
• Protein Accession #: NP_033770.2
• Nucleotide Accession #: NM_009640.4
• Protein Size (# AA): 498
• Molecular Weight: 54 kDa