SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP68090_P050
Price: $0.00
SKU
ARP68090_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for ARP68090_P050
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human ANAPC15
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%; Zebrafish: 90%
Peptide SequenceSynthetic peptide located within the following region: EETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDED
Concentration0.5 mg/ml
Blocking PeptideAvailable upon request
Subunit15
Enhanced Validation
WBY
SPR
YCHAROS
Gene SymbolANAPC15
Alias SymbolsAPC15, HSPC020, C11orf51
NCBI Gene Id25906
Protein NameAnaphase-promoting complex subunit 15
Description of TargetANAPC15 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. In the complex, it plays a role in the release of the mitotic checkpoint complex (MCC) from the APC/C: not required for APC/C activity itself, but promotes the turnover of CDC20 and MCC on the APC/C, thereby participating to the responsiveness of the spindle assembly checkpoint. It is also required for degradation of CDC20.
Uniprot IDP60006
Protein Accession #NP_054761
Nucleotide Accession #NM_014042
Protein Size (# AA)121
Molecular Weight14 kDa
Protein InteractionsANAPC4; CDC26; ANAPC1; ANAPC7; ANAPC5; ANAPC2; ANAPC10; CDC16; CDC23; CDC27; CDC20;
  1. What is the species homology for "ANAPC15 Antibody - N-terminal region (ARP68090_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "ANAPC15 Antibody - N-terminal region (ARP68090_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ANAPC15 Antibody - N-terminal region (ARP68090_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ANAPC15 Antibody - N-terminal region (ARP68090_P050)"?

    This target may also be called "APC15, HSPC020, C11orf51" in publications.

  5. What is the shipping cost for "ANAPC15 Antibody - N-terminal region (ARP68090_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ANAPC15 Antibody - N-terminal region (ARP68090_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ANAPC15 Antibody - N-terminal region (ARP68090_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "14 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ANAPC15 Antibody - N-terminal region (ARP68090_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ANAPC15"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ANAPC15"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ANAPC15"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ANAPC15"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ANAPC15"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ANAPC15"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ANAPC15 Antibody - N-terminal region (ARP68090_P050)
Your Rating