AMPK beta1 Antibody (Phospho-Ser181) (OAAF07344)

Catalog No: OAAF07344 (Formerly GWB-ASB090)

Size:100 ug

Western blot analysis of lysates from COLO205 cells and HUVEC cells, using AMPK beta1 (Phospho-Ser181) Antibody. The lane on the right is blocked with the phospho peptide.

Immunohistochemistry analysis of paraffin-embedded human skeletal muscle, using AMPK beta1 (Phospho-Ser181) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Additional Information: Modification Sites: Human:S182 Mouse:S182 Rat:S182
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human AMPK beta1 around the phosphorylation site of Ser181.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: GTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKP
• Concentration: 1mg/ml
• Specificity: AMPK beta1 (Phospho-Ser181) Antibody detects endogenous levels of AMPK beta1 only when phosphorylated at Ser181.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info: WB: 1:500~1:1000
  IHC: 1:50~1:100
  ELISA: 1:5000

Target Info

• Gene Symbol: PRKAB1
• Gene Full Name: protein kinase AMP-activated non-catalytic subunit beta 1
• Alias Symbols: 5'-AMP-activated protein kinase beta-1 subunit;5'-AMP-activated protein kinase subunit beta-1;AMP-activated protein kinase beta subunit;AMPK;AMPK beta 1;AMPK beta -1 chain;AMPK subunit beta-1;AMPKb;HAMPKb;protein kinase, AMP-activated, beta 1 non-catalytic subunit;protein kinase, AMP-activated, noncatalytic, beta-1.
• NCBI Gene Id: 5564
• Protein Name: 5'-AMP-activated protein kinase subunit beta-1
• Description of Target: Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3).
• Uniprot ID: Q9Y478
• Molecular Weight: 30 kDa