AMPC Recombinant Protein (Pseudomonas aeruginosa) (OPCA02037)

Catalog No: OPCA02037

ampC Recombinant Protein (Pseudomonas aeruginosa) (OPCA02037) in SDS-PAGE showing the molecular weight of approximately 56.65 kDa.

ampC Recombinant Protein (Pseudomonas aeruginosa) (OPCA02037) in SDS-PAGE showing the molecular weight of approximately 56.65 kDa.

Product Info

• Predicted Species Reactivity: Pseudomonas aeruginosa
• Product Format: Liquid or Lyophilized powder
• Host: Pseudomonas aeruginosa
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR
• Protein Sequence: GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 27-397 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Cloning, sequencing and analysis of the structural gene and regulatory region of the Pseudomonas aeruginosa chromosomal ampC beta-lactamase.Lodge J.M., Minchin S.D., Piddock L.J.V., Busby S.J.W.Biochem. J. 272:627-631(1990)

Target Info

• Gene Symbol: ampC
• Gene Full Name: beta-lactamase
• Alias Symbols: beta-lactamase;Cephalosporinase;PA4110.
• NCBI Gene Id: 878149
• Protein Name: Beta-lactamase
• Uniprot ID: P24735
• Protein Accession #: NP_252799.1
  
• Nucleotide Accession #: NC_002516.2
• Protein Size (# AA): Recombinant
• Molecular Weight: 56.7 kDa