Size:100 ul
$319.00
In stock
SKU
ARP42927_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42927_P050-FITC Conjugated

ARP42927_P050-HRP Conjugated

ARP42927_P050-Biotin Conjugated

AMOTL1 Antibody - N-terminal region (ARP42927_P050)

Rating:
80% of 100
Catalog#: ARP42927_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-135330 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human AMOTL1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 79%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
Complete computational species homology data Anti-AMOTL1 (ARP42927_P050)
Peptide Sequence Synthetic peptide located within the following region: LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-AMOTL1 (ARP42927_P050) antibody is Catalog # AAP42927 (Previous Catalog # AAPS13102)
Datasheets/Manuals Printable datasheet for anti-AMOTL1 (ARP42927_P050) antibody
Target Reference Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
Publications

Skouloudaki, K. & Walz, G. YAP1 recruits c-Abl to protect angiomotin-like 1 from Nedd4-mediated degradation. PLoS One 7, e35735 (2012). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit 22558212

Gene Symbol AMOTL1
Official Gene Full Name Angiomotin like 1
Alias Symbols JEAP
NCBI Gene Id 154810
Protein Name Angiomotin-like protein 1
Description of Target AMOTL1 is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.The protein encoded by this gene is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.
Swissprot Id Q8IY63
Protein Accession # NP_570899
Nucleotide Accession # NM_130847
Protein Size (# AA) 956
Molecular Weight 106kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express AMOTL1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express AMOTL1.
Protein Interactions WWOX; SUZ12; NEDD4; HECW2; AMOT; LATS2; YAP1; LATS1; Wwtr1; UBC; Magi1; NEDD4L;
Write Your Own Review
You're reviewing:AMOTL1 Antibody - N-terminal region (ARP42927_P050)
Your Rating