Search Antibody, Protein, and ELISA Kit Solutions

AMOTL1 Antibody - N-terminal region (ARP42927_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42927_P050-FITC Conjugated

ARP42927_P050-HRP Conjugated

ARP42927_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Angiomotin like 1
NCBI Gene Id:
Protein Name:
Angiomotin-like protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-135330 from Santa Cruz Biotechnology.
Description of Target:
AMOTL1 is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.The protein encoded by this gene is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AMOTL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AMOTL1.
The immunogen is a synthetic peptide directed towards the N terminal region of human AMOTL1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 79%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
Complete computational species homology data:
Anti-AMOTL1 (ARP42927_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-AMOTL1 (ARP42927_P050) antibody is Catalog # AAP42927 (Previous Catalog # AAPS13102)
Printable datasheet for anti-AMOTL1 (ARP42927_P050) antibody
Target Reference:
Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Skouloudaki, K. & Walz, G. YAP1 recruits c-Abl to protect angiomotin-like 1 from Nedd4-mediated degradation. PLoS One 7, e35735 (2012). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit 22558212

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

122/05/2019 23:13
  • Overall Experience:
  • Quality:
Transfected HeLa Cells in WB

Submitted by:
Tomasz J. Prószyński, PhD
Nencki Institute of Experimental Biology
Polish Academy of Sciences


1. Species and tissue/cell type used: Hela cells transfected with plasmids encoding mouse AMOTL1 or AMOTL1 or non-transfected.

2. Fixation method: 4% paraformaldehyde, 10min at RT

3. Primary antibody dilution: 1:200, 1h incubation at RT.

4. Secondary antibody and dilution: 1:500, 1h incubation at RT.

5. Protocol: HeLa cells were seeded at the coverslips in 24 well plate at 50 000 cell/well, incubated overnight and

subsequently transfected with plasmids encoding mouse Amotl1 protein. 24 hours after transfection cells were fixed with 4%PFA (in PBS), 10min at RT and preincubate in TBST (0,5% Triton X in PBS) containing 2%BSA and 2%NGS for 30min. Next cells were incubated with primary antibody (1:200 dilution) in TBST (0,2% Triton X in PBS) containing 2%BSA and 2%NGS for 1 hour, wash 3 times 5 min in PBS and incubated in secondary antibody (1:500 dilution) in TBST (0,2% Triton X in PBS) containing 2%BSA and 2%NGS for 45min. Eventually cells were washed 3 times 5min in PBS and mounted on the glass slide. Samples were then analyzed using confocal microscope.

Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...