Loading...
Catalog No: ARP42927_P050
Price: $0.00
SKU
ARP42927_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-AMOTL1 (ARP42927_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Cow, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human AMOTL1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 79%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
Peptide SequenceSynthetic peptide located within the following region: LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE
Concentration0.5 mg/ml
Blocking PeptideFor anti-AMOTL1 (ARP42927_P050) antibody is Catalog # AAP42927 (Previous Catalog # AAPS13102)
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceMehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
Publications

Skouloudaki, K. & Walz, G. YAP1 recruits c-Abl to protect angiomotin-like 1 from Nedd4-mediated degradation. PLoS One 7, e35735 (2012). 22558212

Gene SymbolAMOTL1
Gene Full NameAngiomotin like 1
Alias SymbolsJEAP
NCBI Gene Id154810
Protein NameAngiomotin-like protein 1
Description of TargetAMOTL1 is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.The protein encoded by this gene is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.
Uniprot IDQ8IY63
Protein Accession #NP_570899
Nucleotide Accession #NM_130847
Protein Size (# AA)956
Molecular Weight107 kDa
Protein InteractionsWWOX; SUZ12; NEDD4; HECW2; AMOT; LATS2; YAP1; LATS1; Wwtr1; UBC; Magi1; NEDD4L;
  1. What is the species homology for "AMOTL1 Antibody - N-terminal region (ARP42927_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Cow, Dog, Guinea Pig, Rabbit".

  2. How long will it take to receive "AMOTL1 Antibody - N-terminal region (ARP42927_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AMOTL1 Antibody - N-terminal region (ARP42927_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AMOTL1 Antibody - N-terminal region (ARP42927_P050)"?

    This target may also be called "JEAP" in publications.

  5. What is the shipping cost for "AMOTL1 Antibody - N-terminal region (ARP42927_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AMOTL1 Antibody - N-terminal region (ARP42927_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AMOTL1 Antibody - N-terminal region (ARP42927_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "107 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AMOTL1 Antibody - N-terminal region (ARP42927_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AMOTL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AMOTL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AMOTL1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AMOTL1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AMOTL1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AMOTL1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AMOTL1 Antibody - N-terminal region (ARP42927_P050)
Your Rating
We found other products you might like!