- Gene Symbol:
- AMOTL1
- NCBI Gene Id:
- 154810
- Official Gene Full Name:
- Angiomotin like 1
- Protein Name:
- Angiomotin-like protein 1
- Swissprot Id:
- Q8IY63
- Protein Accession #:
- NP_570899
- Nucleotide Accession #:
- NM_130847
- Alias Symbols:
- JEAP
- Replacement Item:
- This antibody may replace item sc-135330 from Santa Cruz Biotechnology.
- Description of Target:
- AMOTL1 is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.The protein encoded by this gene is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.
- Protein Size (# AA):
- 956
- Molecular Weight:
- 106kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express AMOTL1.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express AMOTL1.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human AMOTL1
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 93%; Dog: 79%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
- Complete computational species homology data:
- Anti-AMOTL1 (ARP42927_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- WWOX; SUZ12; NEDD4; HECW2; AMOT; LATS2; YAP1; LATS1; Wwtr1; UBC; Magi1; NEDD4L;
- Blocking Peptide:
- For anti-AMOTL1 (ARP42927_P050) antibody is Catalog # AAP42927 (Previous Catalog # AAPS13102)
- Datasheets/Manuals:
- Printable datasheet for anti-AMOTL1 (ARP42927_P050) antibody
- Target Reference:
- Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
- Publications:
Skouloudaki, K. & Walz, G. YAP1 recruits c-Abl to protect angiomotin-like 1 from Nedd4-mediated degradation. PLoS One 7, e35735 (2012). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit 22558212
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
