Search Antibody, Protein, and ELISA Kit Solutions

AMHR2 Antibody - N-terminal region : FITC (ARP74381_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74381_P050 Unconjugated

ARP74381_P050-HRP Conjugated

ARP74381_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-377413 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AMHR2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AMHR2.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human AMHR2
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: VRGEPVPEPRPDSGRDWSVELQELPELCFSQVIREGGHAVVWAGQLQGKL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-AMHR2 (ARP74381_P050-FITC) antibody is Catalog # AAP74381
Printable datasheet for anti-AMHR2 (ARP74381_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...