- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for AMH Antibody (OASA00935) |
|---|
| Predicted Species Reactivity | Human |
|---|---|
| Product Format | Liquid |
| Clonality | Monoclonal |
| Clone | 5/6 |
| Isotype | IgG1 |
| Host | Mouse |
| Application | IHC-P, WB |
| Additional Information | Fusion Partners: Spleen cells from immunised T/O outbred mice were fused with cells of the SP2/0 myeloma cell line. Histology Positive Control Tissue: Ovary |
| Reconstitution and Storage | -20°C |
| Immunogen | Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC) |
| Purification | Concentrated Tissue Culture Supernatant containing 0.1M Tris/HCl pH7.4 and 5-10% foetal calf serum. |
| Specificity | Mouse anti Human AMH, clone 5/6 recognizes human anti-mullerian hormone (AMH), originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth. |
| Application Info | IHC-P: 1/20 - 1/40. This product requires antigen retrieval using heat treatment prior to staining of paraffin sections. Sodium citrate buffer pH 6.0 is recommended for this purpose. |
| Reference | 1. Weenen, C. et al. (2004) Anti-Mullerian hormone expression pattern in the human ovary: potential implications for initial and cyclic follicle recruitment. Mol. Hum. Reprod. 10(2):77-83. 2. Gruijters, M. et al. (2003) Anti-Mullerian hormone and its role in ovarian function. Mol. Cell. Endocrinol. 211: 85-90. |
|---|---|
| Gene Symbol | AMH |
| Alias Symbols | MIF, MIS |
| NCBI Gene Id | 268 |
| Protein Name | Muellerian-inhibiting factor |
| Description of Target | AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kDa disulphide linked precursor that is cleaved to release the mature 30kDa homodimer. |
| Uniprot ID | P03971 |
| Protein Accession # | NP_000470.2 |
| Protein Size (# AA) | 560 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "AMH Antibody (OASA00935)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "AMH Antibody (OASA00935)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "AMH Antibody (OASA00935)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "AMH Antibody (OASA00935)"?
This target may also be called "MIF, MIS" in publications.
-
What is the shipping cost for "AMH Antibody (OASA00935)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "AMH Antibody (OASA00935)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "AMH Antibody (OASA00935)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "AMH Antibody (OASA00935)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "AMH"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "AMH"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "AMH"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "AMH"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "AMH"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "AMH"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
