Catalog No: OASA00935 (Formerly GWB-Q00973)
Size:100UL
Price: $249.00
SKU
OASA00935
Availability: Domestic: within 1-2 weeks delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for AMH Antibody (OASA00935)
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid
ClonalityMonoclonal
Clone5/6
IsotypeIgG1
HostMouse
ApplicationIHC-P, WB
Additional InformationFusion Partners: Spleen cells from immunised T/O outbred mice were fused with cells of the SP2/0 myeloma cell line.
Histology Positive Control Tissue: Ovary
Reconstitution and Storage-20°C
ImmunogenSynthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
PurificationConcentrated Tissue Culture Supernatant containing 0.1M Tris/HCl pH7.4 and 5-10% foetal calf serum.
SpecificityMouse anti Human AMH, clone 5/6 recognizes human anti-mullerian hormone (AMH), originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.
Application InfoIHC-P: 1/20 - 1/40. This product requires antigen retrieval using heat treatment prior to staining of paraffin sections. Sodium citrate buffer pH 6.0 is recommended for this purpose.
Reference1. Weenen, C. et al. (2004) Anti-Mullerian hormone expression pattern in the human ovary: potential implications for initial and cyclic follicle recruitment. Mol. Hum. Reprod. 10(2):77-83.
2. Gruijters, M. et al. (2003) Anti-Mullerian hormone and its role in ovarian function. Mol. Cell. Endocrinol. 211: 85-90.
Gene SymbolAMH
Alias SymbolsMIF, MIS
NCBI Gene Id268
Protein NameMuellerian-inhibiting factor
Description of TargetAMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kDa disulphide linked precursor that is cleaved to release the mature 30kDa homodimer.
Uniprot IDP03971
Protein Accession #NP_000470.2
Protein Size (# AA)560
  1. What is the species homology for "AMH Antibody (OASA00935)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "AMH Antibody (OASA00935)"?

    This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".

  3. What buffer format is "AMH Antibody (OASA00935)" provided in?

    This item is provided in "Liquid".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AMH Antibody (OASA00935)"?

    This target may also be called "MIF, MIS" in publications.

  5. What is the shipping cost for "AMH Antibody (OASA00935)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AMH Antibody (OASA00935)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AMH Antibody (OASA00935)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AMH Antibody (OASA00935)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AMH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AMH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AMH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AMH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AMH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AMH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AMH Antibody (OASA00935)
Your Rating
We found other products you might like!