AMH Antibody (OASA00934)

Catalog No: OASA00934 (Formerly GWB-Q00972)

Size:1ML

Staining of ovary tissue from a 25 day old mouse. Formalin fixed paraffin processed tissue

Product Info

• Predicted Species Reactivity: Human, Mouse, Sheep, Squirrel monkey, baboon
• Product Format: Liquid 0.1M Tris/HCl (pH 7.4) and 5-10% foetal calf serum with 0.1% sodium azide
• Clonality: Monoclonal
• Clone: 5/6
• Isotype: IgG1
• Host: Mouse
• Application: Immunohistochemistry-Paraffin|Western blot
• Additional Information: Fusion Partners: Spleen cells from immunised T/O outbred mice were fused with cells of the SP2/0 myeloma cell line.
  Histology Positive Control Tissue: Ovary
• Reconstitution and Storage: This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C. Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended. Expires for 12 months from date of dispatch.
• Immunogen: Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
• Predicted Homology Based on Immunogen Sequence: Human
• Specificity: Mouse anti Human AMH, clone 5/6 recognizes human anti-mullerian hormone (AMH), originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.
  AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kDa disulphide linked precursor that is cleaved to release the mature 30kDa homodimer.
  
• Application Info: Suggested dilution
  Immunohistology - Paraffin*: 1/20 - 1/40
  * This product requires antigen retrieval using heat treatment prior to staining of paraffin sections. Sodium citrate buffer pH 6.0 is recommended for this purpose.
• Reference: 1. Weenen, C. et al. (2004) Anti-Mullerian hormone expression pattern in the human ovary: potential implications for initial and cyclic follicle recruitment. Mol. Hum. Reprod. 10(2):77-83.
  2. Gruijters, M. et al. (2003) Anti-Mullerian hormone and its role in ovarian function. Mol. Cell. Endocrinol. 211: 85-90.
  

Target Info

• Gene Symbol: AMH
• Alias Symbols: MIF, MIS
• NCBI Gene Id: 268
• Protein Name: Muellerian-inhibiting factor
• Description of Target: MOUSE ANTI HUMAN AMH
  
• Uniprot ID: P03971
• Protein Accession #: NP_000470.2
• Protein Size (# AA): 560