Size:100 ul
$319.00
In Stock
SKU
ARP54312_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54312_P050-FITC Conjugated

ARP54312_P050-HRP Conjugated

ARP54312_P050-Biotin Conjugated

AMH Antibody - middle region (ARP54312_P050)

Catalog#: ARP54312_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Western analysis of fetal small intestine lysate.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human AMH
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data Anti-AMH (ARP54312_P050)
Peptide Sequence Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-AMH (ARP54312_P050) antibody is Catalog # AAP54312 (Previous Catalog # AAPP31061)
Datasheets/Manuals Printable datasheet for anti-AMH (ARP54312_P050) antibody
Target Reference Rohr,J., (2008) Hum. Reprod. 23 (5), 1220-1225
Publications

Tezak, B., I. Romero, S. Milton and J. Wyneken. Identifying Sex of Neonate Turtles with Temperature-dependent Sex Determination via Small Blood Samples. Sci Rep. 2020; 10: 5012. IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep 32193464

Gene Symbol AMH
Official Gene Full Name Anti-Mullerian hormone
Alias Symbols MIF, MIS
NCBI Gene Id 268
Protein Name Muellerian-inhibiting factor
Description of Target Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q6GTN3
Protein Accession # NP_000470
Nucleotide Accession # NM_000479
Protein Size (# AA) 560
Molecular Weight 60kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express AMH.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express AMH.
Protein Interactions ZMAT2; ARL8B; ETV5; COPS5; PCSK5; AMHR2; EGFR;
  1. What is the species homology for "AMH Antibody - middle region (ARP54312_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep".

  2. How long will it take to receive "AMH Antibody - middle region (ARP54312_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AMH Antibody - middle region (ARP54312_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AMH Antibody - middle region (ARP54312_P050)"?

    This target may also be called "MIF, MIS" in publications.

  5. What is the shipping cost for "AMH Antibody - middle region (ARP54312_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AMH Antibody - middle region (ARP54312_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AMH Antibody - middle region (ARP54312_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AMH Antibody - middle region (ARP54312_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "AMH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AMH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AMH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AMH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AMH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AMH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AMH Antibody - middle region (ARP54312_P050)
Your Rating
We found other products you might like!