AMH Antibody - middle region (ARP54312_P050)

Catalog No: ARP54312_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: AMH
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml

Immunohistochemistry of formalin-fixed, paraffin-embedded human prostate tissue at an antibody concentration of 5.0ug/ml using anti-AMH antibody (ARP54312_P050)

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Western analysis of fetal small intestine lysate.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AMH
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AMH (ARP54312_P050) antibody is Catalog # AAP54312 (Previous Catalog # AAPP31061)
• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: Rohr,J., (2008) Hum. Reprod. 23 (5), 1220-1225
• Publications:

  Bovine gonadotrophs express anti-Müllerian hormone (AMH): comparison of AMH mRNA and protein expression levels between old Holsteins and young and old Japanese Black females. Reprod Fertil Dev. 31, 810-819 (2019) 30554590

  Decreased Anti-Müllerian hormone and Anti-Müllerian hormone receptor type 2 in hypothalami of old Japanese Black cows. J Vet Med Sci. 82, 1113-1117 (2020). 32554955

  Tezak, B., I. Romero, S. Milton and J. Wyneken. Identifying Sex of Neonate Turtles with Temperature-dependent Sex Determination via Small Blood Samples. Sci Rep. 2020 10: 5012. 32193464

• Description:
  View product citations for AMH Antibody - middle region (ARP54312_P050) on CiteAb

Target Info

• Gene Symbol: AMH
• Gene Full Name: Anti-Mullerian hormone
• Alias Symbols: MIF, MIS
• NCBI Gene Id: 268
• Protein Name: Muellerian-inhibiting factor
• Description of Target: Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q6GTN3
• Protein Accession #: NP_000470
• Nucleotide Accession #: NM_000479
• Protein Size (# AA): 560
• Molecular Weight: 59 kDa
• Protein Interactions: ZMAT2; ARL8B; ETV5; COPS5; PCSK5; AMHR2; EGFR;