SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP60807_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-AMACR (ARP60807_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 85%; Horse: 85%; Human: 100%; Pig: 85%; Rabbit: 79%; Rat: 91%
Peptide SequenceSynthetic peptide located within the following region: SGENPYAPLNLLADFAGGGLMCALGIIMALFDRTRTGKGQVIDANMVEGT
Concentration0.5 mg/ml
Blocking PeptideFor anti-AMACR (ARP60807_P050) antibody is Catalog # AAP60807
Sample Type Confirmation

AMACR is strongly supported by BioGPS gene expression data to be expressed in 721_B

Gene SymbolAMACR
Gene Full NameAlpha-methylacyl-CoA racemase
Alias SymbolsRM, RACE, CBAS4, P504S, AMACRD
NCBI Gene Id23600
Protein NameAlpha-methylacyl-CoA racemase Ensembl ENSP00000371517
Description of TargetThis gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.
Uniprot IDF8W9N1
Protein Accession #NP_001161067
Nucleotide Accession #NM_001167595
Protein Size (# AA)394
Molecular Weight43kDa
Protein InteractionsUBC; PEX5;
  1. What is the species homology for "AMACR Antibody - middle region (ARP60807_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "AMACR Antibody - middle region (ARP60807_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AMACR Antibody - middle region (ARP60807_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "AMACR Antibody - middle region (ARP60807_P050)"?

    This target may also be called "RM, RACE, CBAS4, P504S, AMACRD" in publications.

  5. What is the shipping cost for "AMACR Antibody - middle region (ARP60807_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AMACR Antibody - middle region (ARP60807_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AMACR Antibody - middle region (ARP60807_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "43kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AMACR Antibody - middle region (ARP60807_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AMACR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AMACR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AMACR"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AMACR"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AMACR"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AMACR"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AMACR Antibody - middle region (ARP60807_P050)
Your Rating
We found other products you might like!